Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DNAJC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Rabbit DNAJC2 Polyclonal Antibody | anti-DNAJC2 antibody

DNAJC2 antibody - C-terminal region

Gene Names
DNAJC2; ZRF1; ZUO1; MPP11; MPHOSPH11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNAJC2; Polyclonal Antibody; DNAJC2 antibody - C-terminal region; anti-DNAJC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAV
Sequence Length
621
Applicable Applications for anti-DNAJC2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DNAJC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-DNAJC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-DNAJC2 antibody
This is a rabbit polyclonal antibody against DNAJC2. It was validated on Western Blot

Target Description: This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 2 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C2
NCBI Official Symbol
DNAJC2
NCBI Official Synonym Symbols
ZRF1; ZUO1; MPP11; MPHOSPH11
NCBI Protein Information
dnaJ homolog subfamily C member 2
UniProt Protein Name
DnaJ homolog subfamily C member 2
Protein Family
UniProt Gene Name
DNAJC2
UniProt Synonym Gene Names
MPHOSPH11; MPP11; ZRF1
UniProt Entry Name
DNJC2_HUMAN

NCBI Description

This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

DNAJC2: Acts both as a chaperone in the cytosol and as a chromatin regulator in the nucleus. When cytosolic, acts as a molecular chaperone: component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, stimulates the ATPase activity of the ribosome-associated pool of Hsp70-type chaperones HSPA14 that bind to the nascent polypeptide chain. When nuclear, mediates the switching from polycomb- repressed genes to an active state: specifically recruited at histone H2A ubiquitinated at 'Lys-119' (H2AK119ub), and promotes the displacement of the polycomb PRC1 complex from chromatin, thereby facilitating transcription activation. Specifically binds DNA sequence 5'-GTCAAGC-3'. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA replication; Chaperone; Cell cycle regulation

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: nuclear membrane; cytoplasm; cytosol; nucleus

Molecular Function: ubiquitin binding; DNA binding; histone binding; Hsp70 protein binding; chromatin binding

Biological Process: 'de novo' cotranslational protein folding; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; negative regulation of cell growth; chromatin modification; DNA replication

Research Articles on DNAJC2

Similar Products

Product Notes

The DNAJC2 dnajc2 (Catalog #AAA3214545) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAJC2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAJC2 dnajc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EINEQIRKEK EEAEARMRQA SKNTEKSTGG GGNGSKNWSE DDLQLLIKAV. It is sometimes possible for the material contained within the vial of "DNAJC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.