Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transformer-2 Protein Homolog beta (TRA2B) Recombinant Protein | TRA2B recombinant protein

Recombinant Human Transformer-2 Protein Homolog beta (TRA2B), Partial

Gene Names
TRA2B; SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transformer-2 Protein Homolog beta (TRA2B); Recombinant Human Transformer-2 Protein Homolog beta (TRA2B); Partial; Splicing factor; arginine/serine-rich 10; Transformer-2 protein homolog B; SFRS10; TRA2B recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Highest expression in heart, skeletal muscle and pancreas. Less abundant in kidney, placenta and brain. Lowest expression in kidney and liver.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
111-201aa; Partial
Sequence
RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT
Sequence Length
188
Species
Human
Tag
N-terminal 6xHis-SUMO-tagged
Subcellular Location
Nucleus
Protein Families
Splicing factor SR family
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TRA2B recombinant protein
Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA.
Product Categories/Family for TRA2B recombinant protein
References
"Human transformer-2-beta gene (SFRS10): complete nucleotide sequence, chromosomal localization, and generation of a tissue-specific isoform." Nayler O., Cap C., Stamm S. Genomics 53:191-202(1998).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.5 kDa
NCBI Official Full Name
transformer-2 protein homolog beta isoform 2
NCBI Official Synonym Full Names
transformer 2 beta homolog
NCBI Official Symbol
TRA2B
NCBI Official Synonym Symbols
SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
NCBI Protein Information
transformer-2 protein homolog beta
UniProt Protein Name
Transformer-2 protein homolog beta
Protein Family
UniProt Gene Name
TRA2B
UniProt Synonym Gene Names
SFRS10; TRA-2 beta; TRA2-beta; hTRA2-beta
UniProt Entry Name
TRA2B_HUMAN

NCBI Description

This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Research Articles on TRA2B

Similar Products

Product Notes

The TRA2B tra2b (Catalog #AAA7115258) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 111-201aa; Partial. The amino acid sequence is listed below: RANPDPNCCL GVFGLSLYTT ERDLREVFSK YGPIADVSIV YDQQSRRSRG FAFVYFENVD DAKEAKERAN GMELDGRRIR VDFSITKRPH T. It is sometimes possible for the material contained within the vial of "Transformer-2 Protein Homolog beta (TRA2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.