Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Inhibin beta C Chain (INHBC) Active Protein | INHBC active protein

Recombinant Human Inhibin beta C Chain (INHBC)

Gene Names
INHBC; IHBC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inhibin beta C Chain (INHBC); Recombinant Human Inhibin beta C Chain (INHBC); Inhibin Beta C Chain; Activin Beta-C Chain; INHBC; INHBC active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Expressed in benign prostatic hyperplasia.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 4 mM HCl, 1 mM DTT
Sequence Positions
237-352aa; Full Length of Mature Protein
Sequence
GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Sequence Length
352
Species
Human
Tag
N-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 20 ug/ml.
Subcellular Location
Secreted
Protein Families
TGF-beta Family
Classification
Other Recombinant Protein
Pathway
TGF-beta Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for INHBC active protein
Relevance: Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins, Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland.

Function: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Product Categories/Family for INHBC active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.83 kDa
NCBI Official Full Name
inhibin beta C chain preproprotein
NCBI Official Synonym Full Names
inhibin subunit beta C
NCBI Official Symbol
INHBC
NCBI Official Synonym Symbols
IHBC
NCBI Protein Information
inhibin beta C chain
UniProt Protein Name
Inhibin beta C chain
Protein Family
UniProt Gene Name
INHBC
UniProt Entry Name
INHBC_HUMAN

NCBI Description

This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of homodimeric and heterodimeric activin complexes. The heterodimeric complex may function in the inhibition of activin A signaling. Transgenic mice overexpressing this gene exhibit defects in testis, liver and prostate. [provided by RefSeq, Aug 2016]

Uniprot Description

INHBC: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 12q13.1

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; hormone activity; cytokine activity; transforming growth factor beta receptor binding

Biological Process: regulation of apoptosis; regulation of MAPKKK cascade; cell development; growth

Research Articles on INHBC

Similar Products

Product Notes

The INHBC inhbc (Catalog #AAA7115140) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 237-352aa; Full Length of Mature Protein. The amino acid sequence is listed below: GIDCQGGSRM CCRQEFFVDF REIGWHDWII QPEGYAMNFC IGQCPLHIAG MPGIAASFHT AVLNLLKANT AAGTTGGGSC CVPTARRPLS LLYYDRDSNI VKTDIPDMVV EACGCS. It is sometimes possible for the material contained within the vial of "Inhibin beta C Chain (INHBC), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.