Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-13 (Il13) Active Protein | Il13 active protein

Recombinant Mouse Interleukin-13 (Il13), Partial

Gene Names
Il13; Il-13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-13 (Il13); Recombinant Mouse Interleukin-13 (Il13); Partial; Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13; Il13 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
26-131aa; Partial
Sequence
SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Sequence Length
131
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 10 ng/ml.
Subcellular Location
Secreted
Protein Families
IL-4/IL-13 Family
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il13 active protein
Relevance: Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Ralpha1 with low affinity and triggers association of IL4Ralpha, generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Ralpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.

Function: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages.
Product Categories/Family for Il13 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.7 kDa
NCBI Official Full Name
interleukin-13
NCBI Official Synonym Full Names
interleukin 13
NCBI Official Symbol
Il13
NCBI Official Synonym Symbols
Il-13
NCBI Protein Information
interleukin-13
UniProt Protein Name
Interleukin-13
Protein Family
UniProt Gene Name
Il13
UniProt Synonym Gene Names
Il-13; IL-13
UniProt Entry Name
IL13_MOUSE

Uniprot Description

IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: interleukin-13 receptor binding; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity

Biological Process: response to nicotine; positive regulation of smooth muscle cell proliferation; regulation of proton transport; microglial cell activation; positive regulation of mast cell degranulation; positive regulation of connective tissue growth factor production; positive regulation of tyrosine phosphorylation of Stat6 protein; positive regulation of immunoglobulin production; positive regulation of protein secretion; positive regulation of B cell proliferation; positive regulation of ion transport; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; negative regulation of NAD(P)H oxidase activity; positive regulation of macrophage activation

Research Articles on Il13

Similar Products

Product Notes

The Il13 il13 (Catalog #AAA7115074) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-131aa; Partial. The amino acid sequence is listed below: SVSLPLTLKE LIEELSNITQ DQTPLCNGSM VWSVDLAAGG FCVALDSLTN ISNCNAIYRT QRILHGLCNR KAPTTVSSLP DTKIEVAHFI TKLLSYTKQL FRHGPF. It is sometimes possible for the material contained within the vial of "Interleukin-13 (Il13), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.