Interleukin-36 gamma (IL36G) Active Protein | IL36G active protein

Recombinant Human Interleukin-36 gamma (IL36G)

Cat. Num. AAA7115053

• Gene Names: IL36G; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-36 gamma (IL36G); Recombinant Human Interleukin-36 gamma (IL36G); Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1; IL36G active protein

• Host: E Coli
• Specificity: Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0
• Sequence Positions: 18-169aa; Full Length of Mature Protein
• Sequence: SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
• Sequence Length: 169

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is less than 20 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL36G active protein

Relevance: Interleukin-36 gamma (IL-36gamma) is a member of the interleukin 1 cytokine family that includes three closely related genes, IL-36alpha, beta, and gamma, formerly known as IL-1F6, F8, and F9 respectively. IL-36alpha has been detected in both neuronal and synovial tissue, whereas IL-36beta and IL-36gamma are expressed in both cutaneous and mucosal epithelial cells, including the respiratory tract. IL-36beta and IL-36gamma stimulate proliferation, maturation and/or cytokine expression by innate immune cells (such as keratinocytes and dendritic cells), and adaptive immune cells (neutrophils and T-cells) in both humans and mice. The activity of IL-36alpha is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). IL-36gamma plays an important role in communicating the cell death to surrounding cells.

Function: Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation.

Product Categories/Family for IL36G active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 9665234
• NCBI GeneID: 56300
• NCBI Accession #: NP_062564.1
• NCBI GenBank Nucleotide #: NM_019618.4
• UniProt Accession #: Q9NZH8
• Molecular Weight: 17 kDa
• NCBI Official Full Name: interleukin-36 gamma isoform 1
• NCBI Official Synonym Full Names: interleukin 36 gamma
• NCBI Official Symbol: IL36G
• NCBI Official Synonym Symbols: IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
• NCBI Protein Information: interleukin-36 gamma
• UniProt Protein Name: Interleukin-36 gamma
• Protein Family: Interleukin
• UniProt Gene Name: IL36G
• UniProt Synonym Gene Names: IL1E; IL1F9; IL1H1; IL1RP2; IL-1RP2; IL-1 epsilon; IL-1F9; IL-1H1
• UniProt Entry Name: IL36G_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

Il1f9: Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. Belongs to the IL-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: extracellular space

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cell-cell signaling; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-6 production; innate immune response; negative regulation of myoblast differentiation; inflammatory response