Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Interleukin-36 gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)

Interleukin-36 gamma Active Protein | IL36G active protein

Recombinant Human Interleukin-36 gamma Protein

Gene Names
IL36G; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
Purity
>92% by SDS-PAGE.
Synonyms
Interleukin-36 gamma; Recombinant Human Interleukin-36 gamma Protein; IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2; IL36G active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Sequence
SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Sequence Length
169
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human IL-36 gamma at 1 ug/mL (100 ul/well) can bind recombinant human IL-1 Rrp2 Fc Chimera with a linear range of 0.15 - 5 ug/ml.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Interleukin-36 gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)

SDS-Page (Recombinant Human Interleukin-36 gamma Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 17 kDa.)
Related Product Information for IL36G active protein
Description: Recombinant Human Interleukin-36 gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser18-Asp169) of human Interleukin-36 gamma (Accession #NP_062564.1).

Background: The protein is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.
Product Categories/Family for IL36G active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-36 gamma isoform 1
NCBI Official Synonym Full Names
interleukin 36 gamma
NCBI Official Symbol
IL36G
NCBI Official Synonym Symbols
IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
NCBI Protein Information
interleukin-36 gamma
UniProt Protein Name
Interleukin-36 gamma
Protein Family
UniProt Gene Name
IL36G
UniProt Synonym Gene Names
IL1E; IL1F9; IL1H1; IL1RP2; IL-1RP2; IL-1 epsilon; IL-1F9; IL-1H1
UniProt Entry Name
IL36G_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019]

Uniprot Description

Il1f9: Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. Belongs to the IL-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: extracellular space

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cell-cell signaling; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-6 production; innate immune response; negative regulation of myoblast differentiation; inflammatory response

Research Articles on IL36G

Similar Products

Product Notes

The IL36G il36g (Catalog #AAA9139638) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SMCKPITGTI NDLNQQVWTL QGQNLVAVPR SDSVTPVTVA VITCKYPEAL EQGRGDPIYL GIQNPEMCLY CEKVGEQPTL QLKEQKIMDL YGQPEPVKPF LFYRAKTGRT STLESVAFPD WFIASSKRDQ PIILTSELGK SYNTAFELNI ND. It is sometimes possible for the material contained within the vial of "Interleukin-36 gamma, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.