Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL36GSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit IL36G Polyclonal Antibody | anti-IL36G antibody

IL36G Antibody - middle region

Gene Names
IL36G; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL36G; Polyclonal Antibody; IL36G Antibody - middle region; anti-IL36G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY
Sequence Length
169
Applicable Applications for anti-IL36G antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IL36G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL36GSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL36GSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IL36G antibody
This is a rabbit polyclonal antibody against IL36G. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Product Categories/Family for anti-IL36G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
interleukin-36 gamma isoform 1
NCBI Official Synonym Full Names
interleukin 36 gamma
NCBI Official Symbol
IL36G
NCBI Official Synonym Symbols
IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
NCBI Protein Information
interleukin-36 gamma
UniProt Protein Name
Interleukin-36 gamma
Protein Family
UniProt Gene Name
IL36G
UniProt Synonym Gene Names
IL1E; IL1F9; IL1H1; IL1RP2; IL-1RP2; IL-1 epsilon; IL-1F9; IL-1H1
UniProt Entry Name
IL36G_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]

Uniprot Description

Il1f9: Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. Belongs to the IL-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: extracellular space

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cell-cell signaling; cytokine and chemokine mediated signaling pathway; positive regulation of interleukin-6 production; innate immune response; negative regulation of myoblast differentiation; inflammatory response

Research Articles on IL36G

Similar Products

Product Notes

The IL36G il36g (Catalog #AAA3217255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL36G Antibody - middle region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's IL36G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL36G il36g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITCKYPEALE QGRGDPIYLG IQNPEMCLYC EKVGEQPTLQ LKEQKIMDLY. It is sometimes possible for the material contained within the vial of "IL36G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.