Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Macrophage Colony-Stimulating Factor 1 (Csf1) Active Protein | Csf1 active protein

Recombinant Mouse Macrophage Colony-Stimulating Factor 1 (Csf1), Partial

Gene Names
Csf1; op; Csfm; MCSF; C87615
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Macrophage Colony-Stimulating Factor 1 (Csf1); Recombinant Mouse Macrophage Colony-Stimulating Factor 1 (Csf1); Partial; Macrophage colony-stimulating factor 1; CSF-1; MCSF; Csf1; Csfm; Csf1 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
33-262aa; Partial
Sequence
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Sequence Length
257
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells is less than 10 ng/ml.
Subcellular Location
Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Processed macrophage colony-stimulating factor 1: Secreted, Extracellular Space
Classification
Cytokine
Subdivision
Colony Stimulating Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Csf1 active protein
Relevance: Macrophage colony-stimulating factor 1(M-csf)is a single-pass type I membrane protein. It is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity. The role of M-CSF is not only restricted to the monocyte/macrophage cell lineage. By interacting with its membrane receptor, M-CSF also modulates the proliferation of earlier hematopoietic progenitors and influence numerous physiological processes involved in immunology, metabolism, fertility and pregnancy.

Function: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance.
Product Categories/Family for Csf1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
macrophage colony-stimulating factor 1 isoform 2
NCBI Official Synonym Full Names
colony stimulating factor 1 (macrophage)
NCBI Official Symbol
Csf1
NCBI Official Synonym Symbols
op; Csfm; MCSF; C87615
NCBI Protein Information
macrophage colony-stimulating factor 1
UniProt Protein Name
Macrophage colony-stimulating factor 1
UniProt Gene Name
Csf1
UniProt Synonym Gene Names
Csfm; CSF-1; MCSF
UniProt Entry Name
CSF1_MOUSE

Uniprot Description

M-CSF: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. Aberrant expression of CSF1 or CSF1R can promote cancer cell proliferation, invasion and formation of metastases. Overexpression of CSF1 or CSF1R is observed in a significant percentage of breast, ovarian, prostate, and endometrial cancers. Aberrant expression of CSF1 or CSF1R may play a role in inflammatory diseases, such as rheumatoid arthritis, glomerulonephritis, atherosclerosis, and allograft rejection. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cytokine

Cellular Component: extracellular space; membrane; perinuclear region of cytoplasm; extracellular region; plasma membrane; integral to membrane; receptor complex

Molecular Function: protein binding; protein homodimerization activity; growth factor activity; cytokine activity; macrophage colony stimulating factor receptor binding

Biological Process: positive regulation of monocyte differentiation; ossification; macrophage differentiation; immune system process; positive regulation of osteoclast differentiation; positive regulation of cellular protein metabolic process; positive regulation of odontogenesis of dentine-containing teeth; reproductive developmental process; osteoclast differentiation; positive regulation of multicellular organism growth; odontogenesis; cell proliferation; positive regulation of mononuclear cell proliferation; homeostasis of number of cells within a tissue; positive regulation of protein kinase activity; positive regulation of cell proliferation; innate immune response; positive regulation of Ras protein signal transduction; inflammatory response; positive regulation of macrophage differentiation; positive regulation of cell-matrix adhesion; regulation of ossification; positive regulation of cell migration

Research Articles on Csf1

Similar Products

Product Notes

The Csf1 csf1 (Catalog #AAA7114961) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-262aa; Partial. The amino acid sequence is listed below: KEVSEHCSHM IGNGHLKVLQ QLIDSQMETS CQIAFEFVDQ EQLDDPVCYL KKAFFLVQDI IDETMRFKDN TPNANATERL QELSNNLNSC FTKDYEEQNK ACVRTFHETP LQLLEKIKNF FNETKNLLEK DWNIFTKNCN NSFAKCSSRD VVTKPDCNCL YPKATPSSDP ASASPHQPPA PSMAPLAGLA WDDSQRTEGS SLLPSELPLR IEDPGSAKQR PPRSTCQTLE. It is sometimes possible for the material contained within the vial of "Macrophage Colony-Stimulating Factor 1 (Csf1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.