Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Rabbit RPS7 Polyclonal Antibody | anti-RPS7 antibody

RPS7 antibody - N-terminal region

Gene Names
RPS7; S7; eS7; DBA8
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPS7; Polyclonal Antibody; RPS7 antibody - N-terminal region; anti-RPS7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE
Sequence Length
194
Applicable Applications for anti-RPS7 antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RPS7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-RPS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)
Related Product Information for anti-RPS7 antibody
This is a rabbit polyclonal antibody against RPS7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-RPS7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
40S ribosomal protein S7
NCBI Official Synonym Full Names
ribosomal protein S7
NCBI Official Symbol
RPS7
NCBI Official Synonym Symbols
S7; eS7; DBA8
NCBI Protein Information
40S ribosomal protein S7
UniProt Protein Name
40S ribosomal protein S7
Protein Family
UniProt Gene Name
RPS7
UniProt Entry Name
RS7_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPS7: Required for rRNA maturation. Defects in RPS7 are the cause of Diamond-Blackfan anemia type 8 (DBA8). DBA8 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies. Belongs to the ribosomal protein S7e family.

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: small subunit processome; focal adhesion; membrane; cytoplasm; nucleolus; ribosome; microtubule organizing center; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translation; viral reproduction; viral infectious cycle; translational termination; ribosomal small subunit biogenesis and assembly; translational elongation; cellular protein metabolic process; translational initiation; mRNA catabolic process, nonsense-mediated decay; gene expression; viral transcription; rRNA processing

Disease: Diamond-blackfan Anemia 8

Research Articles on RPS7

Similar Products

Product Notes

The RPS7 rps7 (Catalog #AAA3212589) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPS7 antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPS7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPS7 rps7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFSSSAKIVK PNGEKPDEFE SGISQALLEL EMNSDLKAQL RELNITAAKE. It is sometimes possible for the material contained within the vial of "RPS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.