Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Synaptophysin Recombinant Protein | Syp recombinant protein

Synaptophysin

Gene Names
Syp; Syp1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Synaptophysin; Syp recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-307aa; full length protein
Sequence
MDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFRLHQVYFDAPSCVKGGTTKIFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMMDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGGGYGPQGDYGQQGYGQQGAPTSFSNQM
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Syp recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Syp recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,311 Da
NCBI Official Full Name
synaptophysin
NCBI Official Synonym Full Names
synaptophysin
NCBI Official Symbol
Syp
NCBI Official Synonym Symbols
Syp1
NCBI Protein Information
synaptophysin
UniProt Protein Name
Synaptophysin
Protein Family
UniProt Gene Name
Syp
UniProt Entry Name
SYPH_RAT

NCBI Description

may play a role in synaptic vesicle organization and synaptic plasticity [RGD, Feb 2006]

Uniprot Description

SYP: Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity. Homohexamer or homotetramer. Interacts with SRCIN1. Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype. Belongs to the synaptophysin/synaptobrevin family.

Protein type: Vesicle; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: excitatory synapse; integral to synaptic vesicle membrane; intracellular organelle; membrane; neuron projection; presynaptic active zone; presynaptic membrane; protein complex; synapse; synaptic vesicle; synaptic vesicle membrane; terminal button

Molecular Function: cholesterol binding; identical protein binding; protein binding; protein complex binding; protein domain specific binding; SH2 domain binding; syntaxin-1 binding

Biological Process: endocytosis; regulation of long-term neuronal synaptic plasticity; regulation of neuronal synaptic plasticity; regulation of short-term neuronal synaptic plasticity

Research Articles on Syp

Similar Products

Product Notes

The Syp syp (Catalog #AAA7043404) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-307aa; full length protein. The amino acid sequence is listed below: MDVVNQLVAG GQFRVVKEPL GFVKVLQWVF AIFAFATCGS YTGELRLSVE CANKTESALN IEVEFEYPFR LHQVYFDAPS CVKGGTTKIF LVGDYSSSAE FFVTVAVFAF LYSMGALATY IFLQNKYREN NKGPMMDFLA TAVFAFMWLV SSSAWAKGLS DVKMATDPEN IIKEMPMCRQ TGNTCKELRD PVTSGLNTSV VFGFLNLVLW VGNLWFVFKE TGWAAPFMRA PPGAPEKQPA PGDAYGDAGY GQGPGGYGPQ DSYGPQGGYQ PDYGQPASGG GGYGPQGDYG QQGYGQQGAP TSFSNQM. It is sometimes possible for the material contained within the vial of "Synaptophysin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.