Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytokine receptor common subunit gamma Recombinant Protein | Il2rg recombinant protein

Cytokine receptor common subunit gamma

Gene Names
Il2rg; gc; p64; [g]c; CD132; gamma(c)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytokine receptor common subunit gamma; Il2rg recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-369aa; full length protein
Sequence
WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il2rg recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Il2rg recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,241 Da
NCBI Official Full Name
cytokine receptor common subunit gamma isoform a
NCBI Official Synonym Full Names
interleukin 2 receptor, gamma chain
NCBI Official Symbol
Il2rg
NCBI Official Synonym Symbols
gc; p64; [g]c; CD132; gamma(c)
NCBI Protein Information
cytokine receptor common subunit gamma
UniProt Protein Name
Cytokine receptor common subunit gamma
Protein Family
UniProt Gene Name
Il2rg
UniProt Synonym Gene Names
IL-2 receptor subunit gamma; IL-2R subunit gamma; IL-2RG
UniProt Entry Name
IL2RG_MOUSE

NCBI Description

This gene encodes a transmembrane protein that is a common subunit of several interleukin receptor complexes. These receptors are comprised of alpha and beta subunits in addition to this gamma subunit. Signalling through this pathway in important in immune cell differentiation and function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]

Uniprot Description

IL2RG: Common subunit for the receptors for a variety of interleukins. Defects in IL2RG are the cause of severe combined immunodeficiency X-linked T-cell-negative/B-cell-positive/NK-cell- negative (XSCID); also known as agammaglobulinemia Swiss type. A form of severe combined immunodeficiency (SCID), a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell- mediated immunity, leukopenia, and low or absent antibody levels. Patients present in infancy recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. Defects in IL2RG are the cause of X-linked combined immunodeficiency (XCID). XCID is a less severe form of X-linked immunodeficiency with a less severe degree of deficiency in cellular and humoral immunity than that seen in XSCID. Belongs to the type I cytokine receptor family. Type 5 subfamily.

Protein type: Receptor, cytokine; Membrane protein, integral

Cellular Component: external side of plasma membrane; membrane

Molecular Function: interleukin-2 binding

Biological Process: positive regulation of B cell differentiation; positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation; positive regulation of lymphocyte differentiation; positive regulation of T cell differentiation in the thymus; regulation of gene expression

Research Articles on Il2rg

Similar Products

Product Notes

The Il2rg il2rg (Catalog #AAA7042923) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-369aa; full length protein. The amino acid sequence is listed below: WSSKVLMSSA NEDIKADLIL TSTAPEHLSA PTLPLPEVQC FVFNIEYMNC TWNSSSEPQA TNLTLHYRYK VSDNNTFQEC SHYLFSKEIT SGCQIQKEDI QLYQTFVVQL QDPQKPQRRA VQKLNLQNLV IPRAPENLTL SNLSESQLEL RWKSRHIKER CLQYLVQYRS NRDRSWTELI VNHEPRFSLP SVDELKRYTF RVRSRYNPIC GSSQQWSKWS QPVHWGSHTV EENPSLFALE AVLIPVGTMG LIITLIFVYC WLERMPPIPP IKNLEDLVTE YQGNFSAWSG VSKGLTESLQ PDYSERFCHV SEIPPKGGAL GEGPGGSPCS LHSPYWPPPC YSLKPEA. It is sometimes possible for the material contained within the vial of "Cytokine receptor common subunit gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.