VEGF-B167 active protein

Human VEGF-B167

Cat. Num. AAA692275

• Gene Names: VEGFB; VRF; VEGFL
• Reactivity: Human
• Purity: > 98% by SDS-PAGE & Coomassie stain
• Synonyms: VEGF-B167; Human VEGF-B167; Vascular endothelial growth factor B; VEGFB; VRF; VEGFL; VEGF-B167 active protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 98% by SDS-PAGE & Coomassie stain
• Form/Format: Lyophilized
• Sequence: Result by N-terminal sequencing-MPVSQ; MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQ GRGLELNPDTCRCRKLRR
• Sequence Length: 188

• Reconstitution: The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 ug/mL (100 uL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted VEGF-B167 should be stored in working aliquots at -20 degree C.

SDS-PAGE

(SDS-PAGE analysis of recombinant human VEGF-B167 produced in E. coli. Samples were loaded under reducing and non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Coomassie Blue.)

Testing Data

(VEGF-B167 BioLISA using recombinant human soluble Flt-1 for capturing and recombinant human VEGF-B167 as standard. A mouse anti-human VEGF-B antibody in combination with a goat anti-mouse Biotin-conjugated antibody was used for detection.)

Related Product Information for VEGF-B167 active protein

VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a œcysteine knot like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.

Product Categories/Family for VEGF-B167 active protein

Recombinant Protein; Cytokines & Growth Factors; VEGF-B167

NCBI and Uniprot Product Information

• NCBI GI #: 344179103
• NCBI GeneID: 7423
• NCBI Accession #: NP_001230662.1
• NCBI GenBank Nucleotide #: NM_001243733.1
• UniProt Accession #: P49765; Q16528
• Molecular Weight: 21,261 Da
• NCBI Official Full Name: vascular endothelial growth factor B isoform VEGFB-167
• NCBI Official Synonym Full Names: vascular endothelial growth factor B
• NCBI Official Symbol: VEGFB
• NCBI Official Synonym Symbols: VRF; VEGFL
• NCBI Protein Information: vascular endothelial growth factor B
• UniProt Protein Name: Vascular endothelial growth factor B
• UniProt Gene Name: VEGFB
• UniProt Synonym Gene Names: VRF; VEGF-B; VRF
• UniProt Entry Name: VEGFB_HUMAN

Uniprot Description

VEGFB: Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. Homodimer; disulfide-linked. Can also form heterodimer with VEGF. Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas. Belongs to the PDGF/VEGF growth factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Cytokine; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: extracellular region

Molecular Function: growth factor activity; protein binding

Biological Process: platelet degranulation; response to hypoxia; vascular endothelial growth factor receptor signaling pathway