CD273 protein

CD273-muIg-Purified (with Antibiotics)

Cat. Num. AAA666859

• Reactivity: Human
• Applications: ELISA
• Purity: Purified (with Antibiotics)
• Synonyms: CD273; CD273-muIg-Purified (with Antibiotics); Human CD273(B7-DC; PD-L2)-muIg Fusion Protein; CD273 protein

• Host: CHO cells
• Reactivity: Human
• Purity/Purification: Purified (with Antibiotics)
• Form/Format: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
• Concentration: 0.5 mg/ml (varies by lot)
• Sequence: (221)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtvtcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklgvekknwvernsyscsvvheglhnhhttksfsrtpg(455) Predicted monomeric (non glycosylated) molecular weight: 49 kd. The molecule is dimeric and runs at ~135 kd in SDS-PAGE under native conditions, and ~74 kd reduced.; (20)lftvtvpkelyiiehgsnvtlecnfdtgshvnlgaitaslqkvendtsphreratlleeqlplgkasfhipqvqvrdegqyqciiiygvawdykyltlkvkasyrkinthilkvpetdeveltcqatyplaevswpnvsvpantshsrtpeglyqvtsvlrlkpppgrnfscvfwnthvreltlasidlqsqmeprthpt (220)

• Applicable Applications for CD273 protein: ELISA (EIA)
• Transfectant Cell Line: CHO
• Performance: N-terminal sequence was as predicted: LFTVT. Recombinant CD273-muIg was detectable at 50 ng/ml in EIA using Goat-anti-Mouse-IgG coated plate for capture and recombinant CD279 /Biotin followed by SA/HRP as detection reagents.
• Production: Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography. Purity was >90% by SDS-PAGE.
• Buffer: 50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5 mg/ml Gentamicin Sulfate (as a preservative).
• Group Header: CD273(B7-DC)-muIg
• Preparation and Storage: Store at 2 - 5 degree C. Freeze/Thawing is not recommended.; Product should retain activity for at least 6 months after shipping date when stored as recommended.

Testing Data

Related Product Information for CD273 protein

Information: CD273 (B7-DC, PCDL-2, Programmed cell death ligand 2, Butyrophilin-like protein) is a type I surface molecule with homology to CD80, CD86, CD274. It is expressed primarily by Dendritic cells.and provides a stimulatory signal to CD279 (PD-1, Programmed Death molecule) which serves an important immunoregulatory role by down regulating T cell response. CD273 binds to CD279(PD-1) with a 2- 6 fold higher affinity than CD274(2). Recombinant CD273-muIg binds to recombinant CD279 in EIA.

References

1) E N Rozali, W J Lesterhuis, et al. (2012) Clin Develop Immunol 2012: 656340. 2) P Youngnak, H Konozo, et al. (2003) Biochemical and Biophysical Research Communications 307(3): 672-677.