Testing Data
CD272 protein
CD272(BTLA)-muIg-Purified Preservative Free
Reactivity
Human
Applications
ELISA
Purity
Purified Preservative Free
Synonyms
CD272; CD272(BTLA)-muIg-Purified Preservative Free; Human CD272(BTLA)-muIg Fusion Protein; CD272 protein
Host
CHO cells
Reactivity
Human
Purity/Purification
Purified Preservative Free
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl
Concentration
0.5 mg/ml (varies by lot)
Sequence
(144)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg(378)
Predicted monomeric (non glycosylated) molecular weight: 43.0 kd. The molecule is dimeric and runs at ~100 kd in SDS-PAGE under native conditions, and ~50kd reduced.
(11)ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvksaserpskdmasrp(143)
(1) kpqapelrgs(10)
(11)ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnlieshsttlyvtdvksaserpskdmasrp(143)
(1) kpqapelrgs(10)
Applicable Applications for CD272 protein
ELISA (EIA)
Transfectant Cell Line
CHO
Performance
N-terminal sequence was as predicted: KPQAP. Recombinant protein was detectable at 10 ng/ml in EIA using Goat-anti-Mouse as a capture antibody and recombinant CD270(HVEM)-muIg/Biotin followed by SA/HRP as detection reagents.
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography. Purity was >90% by SDS-PAGE.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl.
Preparation and Storage
Store at 2 - 5 degree C. Open under aseptic conditions. Freeze/Thawing is not recommended.
Product should retain activity for at least 6 months after shipping date when stored as recommended.
Product should retain activity for at least 6 months after shipping date when stored as recommended.
Testing Data
Testing Data
Related Product Information for CD272 protein
Information: Human CD272 (BTLA, B and T Lymphocyte Attenuator) is a member of the Immunoglobulin superfamily and has homology to CD152(CTLA-4). Engagement of BTLA by its co receptor CD270 (HVEM, a TNF superfamily member) can down regulate activated T and B cell responses. BTLA levels on antigen specific CD8+ T cells have been reported to decrease in viral specific, but not melanoma specific activated lines (1). Recombinant CD272-muIg binds to recombinant HVEM-muIg in EIA.
References
1) Derre’ L, DE Speiser, et al. (2010) J Clin Invest 120(1):157-167. 2) Pasero C,D Olive, et al. (2009) Curr Mol Med 9(7): 911-927. 3) Gavrieli M, KM Murphy, et al. (2006) Adv Immunol 92: 152-185.
Similar Products
Product Notes
The CD272 (Catalog #AAA666821) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The CD272(BTLA)-muIg-Purified Preservative Free reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD272 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Researchers should empirically determine the suitability of the CD272 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: (144)gtepr gptikpcppc kcpapnllgg psvfifppki kdvlmislsp ivtcvvvdvs eddpdvqisw fvnnvevhta qtqthredyn stlrvvsalp iqhqdwmsgk efkckvnnkd lpapiertis kpgsvrapqv yvlpppeeem tkkqvtltcm vtdfmpediy vewtnngkte lnykntepvl dsdgsyfmys klrvekknwv ernsyscsvv heglhnhhtt ksfsrtpg(3 78) Predic ted monomeric (non glycosylat ed) molecular weight: 43.0 kd. The molecule is dimeric and runs at ~100 kd in SDS-PAGE under native conditions, and ~50kd reduced.(11)ipyl diwnihgkes cdvqlyikrq sehsilagdp felecpvkyc anrphvtwck lngttcvkle drqtswkeek nisffilhfe pvlpndngsy rcsanfqsnl ieshsttlyv tdvksaserp skdmasrp(1 43) (1) kpqapelrgs (10). It is sometimes possible for the material contained within the vial of "CD272, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
