CD127 protein
CD127-muIg-Purified (with Antibiotics)
Gene Names
IL7R; CD127
Reactivity
Human
Applications
ELISA
Purity
Purified (with Antibiotics)
Synonyms
CD127; CD127-muIg-Purified (with Antibiotics); Human CD127(IL-7Ra)-muIg Fusion Protein; CD127 protein
Host
CHO cells
Reactivity
Human
Purity/Purification
Purified (with Antibiotics)
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Concentration
0.5 mg/ml (varies by lot)
Sequence
(1)kpqapelrgs(10)
the mature extracellular domain of human CD127 (IL-7Ra): (11)esgyaqngdledaelddysfscysqlevngsqhsltcafedpdvnitnlefeicgalvevkclnfrklqeiyfietkkflligksnicvkvgeksltckkidlttivkpeapfdlsvvyregandfvtfntshlqkkyvkvlmhdvayrqekdenkwthvnlsstkltllqrklqpaamyeikvrsipdhyfkgfwsewspsyyfrtpeinnssgemd(229)
murine IgG2a Fc + hinge regions: (230)gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(464)
(464 aa total). The molecule is dimeric with a predicted monomeric non glycosylated molecular weight of 52.8 kd.
Sequence Length
459
Applicable Applications for CD127 protein
ELISA (EIA)
Transfectant Cell Line
CHO
Performance
Recombinant soluble CD127-muIg was reactive with anti-CD127 clone 40131 as well as clone ANC8F2 in EIA and FACS.
Production
Human CD127-muIg fusion protein was Protein A purified from (low FBS containing) tissue culture supernatant of CHO transfectants.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5 mg/ml Gentamicin sulfate (as a preservative).
Group Header
CD127-muIg
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.
Related Product Information for CD127 protein
Information: CD127 (IL-7Ra) is the specific receptor component for the cytokine Interleukin -7 (IL-7). It is found on a wide variety of hematopoietic cell types including B cell precursors, and the majority of T cells. Its expression levels are decreased on T cells following activation. CD127 can dimerize with CD132(IL-2Rg) to form a high affinity IL-7 receptor (1). CD127 engagement is necessary for T cell development in humans (2).
References
1) Noguchi, M. et al., 1993, Science 262:1877. 2) Pribyl, J.A. and T.W. LeBien, 1996, Proc. Natl. Acad. Sci. 93:10348. 3) Goodwin RG, Friend D, Ziegler SF, et al. Cell. 1990;60:941.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
51,365 Da
NCBI Official Full Name
CD127 protein
NCBI Official Symbol
IL7R
NCBI Official Synonym Symbols
CD127
NCBI Protein Information
interleukin-7 receptor subunit alpha
UniProt Protein Name
CD127 protein
UniProt Gene Name
CD127
UniProt Entry Name
B9ZSM5_PIG
Research Articles on CD127
Similar Products
Product Notes
The CD127 cd127 (Catalog #AAA666848) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The CD127-muIg-Purified (with Antibiotics) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD127 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Researchers should empirically determine the suitability of the CD127 cd127 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: (1)kpqapel rgs(10) th e mature extracellu lar domain of human CD127 (IL-7Ra): (11)esgyaq ngdledaeld dysfscysql evngsqhslt cafedpdvni tnlefeicga lvevkclnfr klqeiyfiet kkflligksn icvkvgeksl tckkidltti vkpeapfdls vvyregandf vtfntshlqk kyvkvlmhdv ayrqekdenk wthvnlsstk ltllqrklqp aamyeikvrs ipdhyfkgfw sewspsyyfr tpeinnssge md(229) mu rine IgG2a Fc + hinge regions: (230)gtepr gptikpcppc kcpapnllgg psvfifppki kdvlmislsp ivtcvvvdvs eddpdvqisw fvnnvevhta qtqthredyn stlrvvsalp iqhqdwmsgk efkckvnnkd lpapiertis kpgsvrapqv yvlpppeeem tkkqvtltcm vtdfmpediy vewtnngkte lnykntepvl dsdgsyfmys klrvekknwv ernsyscsvv heglhnhhtt ksfsrtpgk( 464) (464 aa total). The molecule is dimeric with a predicted monomeric non glycosylat ed molecular weight of 52.8 kd. It is sometimes possible for the material contained within the vial of "CD127, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
