Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CDIPT Monoclonal Antibody | anti-CDIPT antibody

CDIPT, ID (CDIPT, PIS, PIS1, CDP-diacylglycerol--inositol 3-phosphatidyltransferase, Phosphatidylinositol Synthase)

Gene Names
CDIPT; PIS; PIS1
Reactivity
Human
Applications
ELISA
Purity
Ascites
Ascites
Synonyms
CDIPT; Monoclonal Antibody; ID (CDIPT; PIS; PIS1; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; Phosphatidylinositol Synthase); Anti -CDIPT; anti-CDIPT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
1F8
Specificity
Recognizes human CDIPT.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
Applicable Applications for anti-CDIPT antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant protein corresponding to aa1-213 from CDIPT with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-CDIPT antibody
CDIPT is a protein which is phosphatidylinositol breakdown products that are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus.
Product Categories/Family for anti-CDIPT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,539 Da
NCBI Official Full Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
NCBI Official Synonym Full Names
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
NCBI Official Symbol
CDIPT
NCBI Official Synonym Symbols
PIS; PIS1
NCBI Protein Information
CDP-diacylglycerol--inositol 3-phosphatidyltransferase; PI synthase; PtdIns synthase; phosphatidylinositol synthase
UniProt Protein Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase
UniProt Gene Name
CDIPT
UniProt Synonym Gene Names
PIS; PIS1; PI synthase
UniProt Entry Name
CDIPT_HUMAN

NCBI Description

Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.

Catalytic activity: CDP-diacylglycerol + myo-inositol = CMP + phosphatidyl-1D-myo-inositol.

Cofactor: Magnesium.Manganese.

Enzyme regulation: Inhibited by PtdIns (product inhibition), phosphatidylinositol phosphate, and nucleoside di- and tri-phosphates.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity. Golgi apparatus membrane; Multi-pass membrane protein

By similarity. Cell membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Widely expressed. Higher expression in adult liver and skeletal muscle, slightly lower levels seen in pancreas, kidney, lung, placenta, brain, heart, leukocyte, colon, small intestine, ovary, testis, prostate, thymus and spleen. In fetus, expressed in kidney, liver, lung and brain.

Sequence similarities: Belongs to the CDP-alcohol phosphatidyltransferase class-I family.

Biophysicochemical propertiespH dependence:Optimum pH is 9.0.Temperature dependence:Optimum temperature is 50 degrees Celsius.

Research Articles on CDIPT

Similar Products

Product Notes

The CDIPT cdipt (Catalog #AAA648768) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDIPT, ID (CDIPT, PIS, PIS1, CDP-diacylglycerol--inositol 3-phosphatidyltransferase, Phosphatidylinositol Synthase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDIPT can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the CDIPT cdipt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPDENIFLFV PNLIGYARIV FAIISFYFMP CCPLTASSFY LLSGLLDAFD GHAARALNQG TRFGAMLDML TDRCSTMCLL VNLALLYPGA TLFFQISMSL DVASHWLHLH SSVVRGSESH KMIDLSGNPV LRIYYTSRPA LFTLCAGNEL FYCLLYLFHF SEGPLVGSVG LFRMGLWVTA PIALLKSLIS VIHLITAARN MAALDAADRA KKK. It is sometimes possible for the material contained within the vial of "CDIPT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.