Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADRA1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ADRA1A Polyclonal Antibody | anti-ADRA1A antibody

ADRA1A Antibody-C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADRA1A; Polyclonal Antibody; ADRA1A Antibody-C-terminal region; Alpha-1A adrenergic receptor; ADRA1C; ADRA1L1; ALPHA1AAR; anti-ADRA1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
FSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQV
Applicable Applications for anti-ADRA1A antibody
Western Blot (WB)
Protein Size
466 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ADRA1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADRA1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADRA1ASample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADRA1A antibody
Description of Target: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1A-adrenergic receptor. Alternative splicing of this gene generates four transcript variants, which encode four different isoforms with distinct C-termini but having similar ligand binding properties.

NCBI and Uniprot Product Information

NCBI GeneID
148
UniProt Accession #
Molecular Weight
51kDa
UniProt Protein Name
Alpha-1A adrenergic receptor
UniProt Gene Name
ADRA1A
UniProt Synonym Gene Names
ADRA1C; Alpha-1A adrenoceptor
UniProt Entry Name
ADA1A_HUMAN

Uniprot Description

ADRA1A: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes. Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: nuclear membrane; integral to plasma membrane; T-tubule; plasma membrane; nucleus; Z disc

Molecular Function: protein heterodimerization activity; alpha1-adrenergic receptor activity

Biological Process: apoptosis; response to hormone stimulus; positive regulation of systemic arterial blood pressure; norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure; signal transduction; negative regulation of cell proliferation; elevation of cytosolic calcium ion concentration; smooth muscle contraction; positive regulation of MAPKKK cascade; cell-cell signaling; positive regulation of smooth muscle contraction; positive regulation of action potential; cell growth; aging; response to drug; adult heart development; positive regulation of the force of heart contraction by epinephrine-norepinephrine; positive regulation of synaptic transmission, GABAergic; micturition; organ growth; negative regulation of heart rate in baroreceptor response to increased systemic arterial blood pressure; G-protein coupled receptor protein signaling pathway; negative regulation of Rho protein signal transduction; phospholipase C activation; positive regulation of vasoconstriction; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of heart rate by epinephrine-norepinephrine

Similar Products

Product Notes

The ADRA1A adra1a (Catalog #AAA3249905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRA1A Antibody-C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADRA1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADRA1A adra1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSSMPRGSAR ITVSKDQSSC TTARVRSKSF LQVCCCVGPS TPSLDKNHQV. It is sometimes possible for the material contained within the vial of "ADRA1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.