Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human MS4A8B Monoclonal Antibody | anti-MS4A8 antibody

MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B)

Gene Names
MS4A8; MS4A4; 4SPAN4; CD20L5; MS4A8B
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MS4A8B; Monoclonal Antibody; MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8; Four-span Transmembrane Protein 4; Membrane-spanning 4-domains Subfamily A Member 8B; 4SPAN4; MS4A8B); Anti -MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8; anti-MS4A8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B4
Specificity
Recognizes human MS4A8B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Applicable Applications for anti-MS4A8 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant corresponding to aa1-251 from human MS4A8B (AAH22895) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-MS4A8 antibody
This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members.
Product Categories/Family for anti-MS4A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,290 Da
NCBI Official Full Name
membrane-spanning 4-domains subfamily A member 8
NCBI Official Synonym Full Names
membrane-spanning 4-domains, subfamily A, member 8
NCBI Official Symbol
MS4A8
NCBI Official Synonym Symbols
MS4A4; 4SPAN4; CD20L5; MS4A8B
NCBI Protein Information
membrane-spanning 4-domains subfamily A member 8; four-span transmembrane protein 4; membrane-spanning 4-domains, subfamily A, member 8B
UniProt Protein Name
Membrane-spanning 4-domains subfamily A member 8
UniProt Gene Name
MS4A8
UniProt Synonym Gene Names
4SPAN4; MS4A8B
UniProt Entry Name
M4A8_HUMAN

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be involved in signal transduction as a component of a multimeric receptor complex.

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Expressed by hematopoietic tissues and cells lines.

Sequence similarities: Belongs to the MS4A family.

Research Articles on MS4A8

Similar Products

Product Notes

The MS4A8 ms4a8 (Catalog #AAA647163) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MS4A8B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the MS4A8 ms4a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNSMTSAVPV ANSVLVVAPH NGYPVTPGIM SHVPLYPNSQ PQVHLVPGNP PSLVSNVNGQ PVQKALKEGK TLGAIQIIIG LARIGLGSIM ATVLVGEYLS ISFYGGFPFW GGLWFIISGS LSVAAENQPY SYCLLSGSLG LNIVSAICSA VGVILFITDL SIPHPYAYPD YYPYAWGVNP GMAISGVLLV FCLLEFGIAC ASSHFGCQLV CCQSSNVSVI YPNIYAANPV ITPEPVTSPP SYSSEIQANK. It is sometimes possible for the material contained within the vial of "MS4A8B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.