Mouse anti-Human MS4A8B Polyclonal Antibody | anti-MS4A8 antibody

MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B)

Cat. Num. AAA647463

• Gene Names: MS4A8; MS4A4; 4SPAN4; CD20L5; MS4A8B
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MS4A8B; Polyclonal Antibody; MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8; Four-span Transmembrane Protein 4; Membrane-spanning 4-domains Subfamily A Member 8B; 4SPAN4; MS4A8B); Anti -MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8; anti-MS4A8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MS4A8B.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK

• Applicable Applications for anti-MS4A8 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human MS4A8B, aa1-251 (AAH22895).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MS4A8B expression in transfected 293T cell line by MS4A8B polyclonal antibody. Lane 1: MS4A8B transfected lysate (27.61kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MS4A8 antibody

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members.

Product Categories/Family for anti-MS4A8 antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13899295
• NCBI GeneID: 83661
• NCBI Accession #: NP_113645.1
• NCBI GenBank Nucleotide #: NM_031457.1
• UniProt Accession #: Q9BY19; Q8TCA5
• Molecular Weight: 26,290 Da
• NCBI Official Full Name: membrane-spanning 4-domains subfamily A member 8
• NCBI Official Synonym Full Names: membrane-spanning 4-domains, subfamily A, member 8
• NCBI Official Symbol: MS4A8
• NCBI Official Synonym Symbols: MS4A4; 4SPAN4; CD20L5; MS4A8B
• NCBI Protein Information: membrane-spanning 4-domains subfamily A member 8; four-span transmembrane protein 4; membrane-spanning 4-domains, subfamily A, member 8B
• UniProt Protein Name: Membrane-spanning 4-domains subfamily A member 8
• Protein Family: Membrane-spanning 4-domains subfamily
• UniProt Gene Name: MS4A8
• UniProt Synonym Gene Names: 4SPAN4; MS4A8B
• UniProt Entry Name: M4A8_HUMAN

NCBI Description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May be involved in signal transduction as a component of a multimeric receptor complex.

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Expressed by hematopoietic tissues and cells lines.

Sequence similarities: Belongs to the MS4A family.