Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Mouse anti-Human MNDA Monoclonal Antibody | anti-MNDA antibody

MNDA (Myeloid Cell Nuclear Differentiation antigen, PYHIN3) (HRP)

Gene Names
MNDA; PYHIN3
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry
Purity
Purified
Synonyms
MNDA; Monoclonal Antibody; MNDA (Myeloid Cell Nuclear Differentiation antigen; PYHIN3) (HRP); Myeloid Cell Nuclear Differentiation antigen; PYHIN3; anti-MNDA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1H2
Specificity
Recognizes MNDA. Species Crossreactivity: human
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MNDA antibody
Immunofluorescence (IF), Immunohistochemistry (IHC)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MNDA (NP_002423.1, 311aa-407aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MNDA on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MNDA is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MNDA is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MNDA on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-MNDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,836 Da
NCBI Official Full Name
myeloid cell nuclear differentiation antigen
NCBI Official Synonym Full Names
myeloid cell nuclear differentiation antigen
NCBI Official Symbol
MNDA
NCBI Official Synonym Symbols
PYHIN3
NCBI Protein Information
myeloid cell nuclear differentiation antigen
UniProt Protein Name
Myeloid cell nuclear differentiation antigen
UniProt Gene Name
MNDA
UniProt Entry Name
MNDA_HUMAN

NCBI Description

The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, designated Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mRNA, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May act as a transcriptional activator/repressor in the myeloid lineage. Plays a role in the granulocyte/monocyte cell-specific response to interferon. Stimulates the DNA binding of the transcriptional repressor protein YY1.

Subunit structure: Participates in a ternary complex with YY1 and the YY1 target DNA element. Binds nucleolin and nucleophosmin/NPM/B23.

Subcellular location: Nucleus. Cytoplasm. Note: Uniformly distributed throughout the interphase cell nucleus. Associates with chromatin.

Tissue specificity: Expressed constitutively in cells of the myeloid lineage. Found in promyelocyte stage cells as well as in all other stage cells including peripheral blood monocytes and granulocytes. Also appear in myeloblast cells in some cases of acute myeloid Leukemia. Ref.5

Induction: Strongly induced by alpha interferon which selectively affects expression in late stage cells in the monocytic but not the granulocytic lineage. Induced in vitro by dimethylsulfoxide and 1,25 dihydroxyvitamin D3. Ref.4 Ref.5 Ref.6

Domain: Its N-terminal half (200 amino acids) is sufficient for maximum enhancement of YY1 DNA binding and a portion of this sequence is responsible for binding YY1.

Sequence similarities: Contains 1 DAPIN domain.Contains 1 HIN-200 domain.

Research Articles on MNDA

Similar Products

Product Notes

The MNDA mnda (Catalog #AAA6182293) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MNDA (Myeloid Cell Nuclear Differentiation antigen, PYHIN3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MNDA can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MNDA mnda for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MNDA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.