Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)

Mouse anti-Human, Mouse NR2E1 Monoclonal Antibody | anti-NR2E1 antibody

NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX)

Gene Names
NR2E1; TLL; TLX; XTLL
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NR2E1; Monoclonal Antibody; NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1; Nuclear Receptor TLX; Protein Tailless Homolog; Tll; hTll; TLX); Anti -NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1; anti-NR2E1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes human NR2E1. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK
Applicable Applications for anti-NR2E1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa249-343 from human NR2E1 (NP_003260) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)

Western Blot (WB) (NR2E1 monoclonal antibody, Western Blot analysis of NR2E1 expression in NIH/3T3.)
Related Product Information for anti-NR2E1 antibody
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity. May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity. May be involved in retinoic acic receptor (RAR) regulation in retinal cells.
Product Categories/Family for anti-NR2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,589 Da
NCBI Official Full Name
nuclear receptor subfamily 2 group E member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 2, group E, member 1
NCBI Official Symbol
NR2E1
NCBI Official Synonym Symbols
TLL; TLX; XTLL
NCBI Protein Information
nuclear receptor subfamily 2 group E member 1; hTll; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog
UniProt Protein Name
Nuclear receptor subfamily 2 group E member 1
UniProt Gene Name
NR2E1
UniProt Synonym Gene Names
TLX; Tll; hTll
UniProt Entry Name
NR2E1_HUMAN

NCBI Description

The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]

Uniprot Description

Function: Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity

By similarity. May be required to pattern anterior brain differentiation. Involved in the regulation of retinal development and essential for vision. During retinogenesis, regulates PTEN-Cyclin D expression via binding to the promoter region of PTEN and suppressing its activity

By similarity. May be involved in retinoic acic receptor (RAR) regulation in retinal cells. Ref.2

Subunit structure: Monomer

By similarity. Interacts with ATN1; the interaction represses the transcription

By similarity.

Subcellular location: Nucleus

By similarity.

Tissue specificity: Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus. Ref.1

Sequence similarities: Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.

Research Articles on NR2E1

Similar Products

Product Notes

The NR2E1 nr2e1 (Catalog #AAA645848) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NR2E1 (Nuclear Receptor Subfamily 2 Group E Member 1, Nuclear Receptor TLX, Protein Tailless Homolog, Tll, hTll, TLX) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NR2E1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the NR2E1 nr2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NGDNTDSQKL NKIISEIQAL QEVVARFRQL RLDATEFACL KCIVTFKAVP THSGSELRSF RNAAAIAALQ DEAQLTLNSY IHTRYPTQPC RFGK. It is sometimes possible for the material contained within the vial of "NR2E1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.