Western Blot (WB)
(Western Blot analysis of LRRN4CL expression in transfected 293T cell line by LRRN4CL polyclonal antibody. Lane 1: LOC221091 transfected lysate (26.18kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human LRRN4CL Polyclonal Antibody | anti-LRRN4CL antibody
LRRN4CL (LOC221091, LRRN4 C-terminal-like Protein, MGC61707, UNQ728/PRO1410)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LRRN4CL; Polyclonal Antibody; LRRN4CL (LOC221091; LRRN4 C-terminal-like Protein; MGC61707; UNQ728/PRO1410); Anti -LRRN4CL (LOC221091; anti-LRRN4CL antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LOC221091.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSRLAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGAL
Applicable Applications for anti-LRRN4CL antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LOC221091, aa1-238 (NP_981967.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of LRRN4CL expression in transfected 293T cell line by LRRN4CL polyclonal antibody. Lane 1: LOC221091 transfected lysate (26.18kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LRRN4CL expression in transfected 293T cell line by LRRN4CL polyclonal antibody. Lane 1: LOC221091 transfected lysate (26.18kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-LRRN4CL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,410 Da
NCBI Official Full Name
LRRN4 C-terminal-like protein
NCBI Official Synonym Full Names
LRRN4 C-terminal like<
NCBI Official Symbol
LRRN4CL
NCBI Protein Information
LRRN4 C-terminal-like protein
UniProt Protein Name
LRRN4 C-terminal-like protein
Protein Family
UniProt Gene Name
LRRN4CL
UniProt Entry Name
LRN4L_BOVIN
Uniprot Description
Subcellular location: Membrane; Single-pass type I membrane protein
Potential.
Sequence similarities: Contains 1 fibronectin type-III domain.
Sequence caution: The sequence AAI04602.1 differs from that shown. Reason: Erroneous initiation.
Similar Products
Product Notes
The LRRN4CL lrrn4cl (Catalog #AAA643463) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LRRN4CL (LOC221091, LRRN4 C-terminal-like Protein, MGC61707, UNQ728/PRO1410) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRRN4CL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LRRN4CL lrrn4cl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLGSPCLLWL LAVTFLVPRA QPLAPQDFEE EEADETETAW PPLPAVPCDY DHCRHLQVPC KELQRVGPAA CLCPGLSSPA QPPDPPRMGE VRIAAEEGRA VVHWCAPFSP VLHYWLLLWD GSEAAQKGPP LNATVRRAEL KGLKPGGIYV VCVVAANEAG ASRVPQAGGE GLEGADIPAF GPCSRLAVPP NPRTLVHAAV GVGTALALLS CAALVWHFCL RDRWGCPRRA AARAAGAL. It is sometimes possible for the material contained within the vial of "LRRN4CL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
