Western Blot (WB)
(Western Blot analysis of TMEM54 expression in transfected 293T cell line by TMEM54 polyclonal antibody. Lane 1: TMEM54 transfected lysate (18.3kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human TMEM54 Polyclonal Antibody | anti-TMEM54 antibody
TMEM54 (Transmembrane Protein 54, Beta-casein-like Protein, BCLP, CAC1, Protein CAC-1)
Gene Names
TMEM54; BCLP; CAC1; CAC-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TMEM54; Polyclonal Antibody; TMEM54 (Transmembrane Protein 54; Beta-casein-like Protein; BCLP; CAC1; Protein CAC-1); Anti -TMEM54 (Transmembrane Protein 54; anti-TMEM54 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMEM54.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIVGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL
Applicable Applications for anti-TMEM54 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMEM54, aa1-169 (AAH23260.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TMEM54 expression in transfected 293T cell line by TMEM54 polyclonal antibody. Lane 1: TMEM54 transfected lysate (18.3kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TMEM54 expression in transfected 293T cell line by TMEM54 polyclonal antibody. Lane 1: TMEM54 transfected lysate (18.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TMEM54 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
23,772 Da
NCBI Official Full Name
TMEM54 protein
NCBI Official Synonym Full Names
transmembrane protein 54
NCBI Official Symbol
TMEM54
NCBI Official Synonym Symbols
BCLP; CAC1; CAC-1
NCBI Protein Information
transmembrane protein 54; protein CAC-1; beta-casein-like protein
UniProt Protein Name
Transmembrane protein 54
Protein Family
UniProt Gene Name
TMEM54
UniProt Synonym Gene Names
BCLP; CAC1
UniProt Entry Name
TMM54_HUMAN
Uniprot Description
TMEM54: Belongs to the TMEM54 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1p35-p34
Cellular Component: integral to membrane
Similar Products
Product Notes
The TMEM54 tmem54 (Catalog #AAA6004623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM54 (Transmembrane Protein 54, Beta-casein-like Protein, BCLP, CAC1, Protein CAC-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM54 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TMEM54 tmem54 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MCLRLGGLSV GDFRKVLMKT GLVLVVLGHV SFITAALFHG TVLRYVGTPQ DAVALQYCVV NILSVTSAIV GKALLAACTF GSSELLALAP DCPFDPTRIY SSSLCLWGIA LVLCVAENVF AVRCAQLTHQ LLELRPWWGK SSHHMMRENP ELVEGRDLLS CTSSEPLTL. It is sometimes possible for the material contained within the vial of "TMEM54, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
