Western Blot (WB)
(Western Blot analysis of EPB41L4A expression in transfected 293T cell line by EPB41L4A polyclonal antibody. Lane 1: EPB41L4A transfected lysate (20.35kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human EPB41L4A Polyclonal Antibody | anti-EPB41L4A antibody
EPB41L4A (Band 4.1-like Protein 4A, Protein NBL4, EPB41L4, DKFZp566L203, FLJ38738, NBL4)
Gene Names
EPB41L4A; NBL4; EPB41L4
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
EPB41L4A; Polyclonal Antibody; EPB41L4A (Band 4.1-like Protein 4A; Protein NBL4; EPB41L4; DKFZp566L203; FLJ38738; NBL4); Anti -EPB41L4A (Band 4.1-like Protein 4A; anti-EPB41L4A antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EPB41L4A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRLPCPVNTAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLM
Applicable Applications for anti-EPB41L4A antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human EPB41L4A, aa1-185 (AAH31042.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of EPB41L4A expression in transfected 293T cell line by EPB41L4A polyclonal antibody. Lane 1: EPB41L4A transfected lysate (20.35kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of EPB41L4A expression in transfected 293T cell line by EPB41L4A polyclonal antibody. Lane 1: EPB41L4A transfected lysate (20.35kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-EPB41L4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
79,059 Da
NCBI Official Full Name
EPB41L4A protein
NCBI Official Synonym Full Names
erythrocyte membrane protein band 4.1 like 4A
NCBI Official Symbol
EPB41L4A
NCBI Official Synonym Symbols
NBL4; EPB41L4
NCBI Protein Information
band 4.1-like protein 4A; erythrocyte protein band 4.1-like 4
UniProt Protein Name
Band 4.1-like protein 4A
Protein Family
UniProt Gene Name
EPB41L4A
UniProt Synonym Gene Names
EPB41L4
UniProt Entry Name
E41LA_HUMAN
NCBI Description
Members of the band 4.1 protein superfamily, including EPB41L4A, are thought to regulate the interaction between the cytoskeleton and plasma membrane (Ishiguro et al., 2000 [PubMed 10874211]).[supplied by OMIM, Jul 2008]
Uniprot Description
Subcellular location: Cytoplasm › cytoskeleton
By similarity.
Tissue specificity: Expressed in many tissues. High levels of expression in brain, liver, thymus and peripheral blood leukocytes and low levels of expression in heart, kidney, testis and colon.
Sequence similarities: Contains 1 FERM domain.
Research Articles on EPB41L4A
Similar Products
Product Notes
The EPB41L4A epb41l4a (Catalog #AAA646382) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPB41L4A (Band 4.1-like Protein 4A, Protein NBL4, EPB41L4, DKFZp566L203, FLJ38738, NBL4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPB41L4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the EPB41L4A epb41l4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGCFCAVPEE FYCEVLLLDE SKLTLTTQQQ GIKKSTKGSV VLDHVFHHVN LVEIDYFGLR YCDRSHQTYW LDPAKTLAEH KELINTGPPY TLYFGIKFYA EDPCKLKEEI TRYQFFLQVK QDVLQGRLPC PVNTAAQLGA YAIQSELGDY DPYKHTAGYV SEYRFVPDQK EELEEAIERI HKTLM. It is sometimes possible for the material contained within the vial of "EPB41L4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
