Rabbit anti-Human TAF7 Polyclonal Antibody | anti-TAF7 antibody

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (MaxLight 750)

Cat. Num. AAA6395959

• Gene Names: TAF7; TAF2F; TAFII55
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF7; Polyclonal Antibody; TAF7 (TAF2F; TAFII55; Transcription Initiation Factor TFIID Subunit 7; RNA Polymerase II TBP-associated Factor Subunit F; Transcription Initiation Factor TFIID 55kD Subunit; TAF(II)55; TAFII-55) (MaxLight 750); anti-TAF7 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human TAF7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.

• Applicable Applications for anti-TAF7 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human TAF7, aa1-349 (NP_005633.2).
• Immunogen Sequence: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
• Conjugate: MaxLight750
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-TAF7 antibody

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.

Product Categories/Family for anti-TAF7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 14717407
• NCBI GeneID: 6879
• NCBI Accession #: NP_005633.2
• NCBI GenBank Nucleotide #: NM_005642.2
• UniProt Accession #: Q15545; Q13036; B2RBV9
• Molecular Weight: 40,259 Da
• NCBI Official Full Name: transcription initiation factor TFIID subunit 7
• NCBI Official Synonym Full Names: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
• NCBI Official Symbol: TAF7
• NCBI Official Synonym Symbols: TAF2F; TAFII55
• NCBI Protein Information: transcription initiation factor TFIID subunit 7; TAFII-55; TAF(II)55; TBP-associated factor F; transcription factor IID subunit TAFII55; RNA polymerase II TBP-associated factor subunit F; transcription initiation factor TFIID 55 kDa subunit; transcription
• UniProt Protein Name: Transcription initiation factor TFIID subunit 7
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF7
• UniProt Synonym Gene Names: TAF2F; TAFII55; TAF(II)55; TAFII-55; TAFII55
• UniProt Entry Name: TAF7_HUMAN

NCBI Description

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF7: Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively). Belongs to the TAF7 family.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; Golgi apparatus; transcription factor TFIID complex; transcription elongation factor complex b

Molecular Function: histone acetyltransferase binding; protein binding; vitamin D receptor binding; transcription coactivator activity; thyroid hormone receptor binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; estrogen receptor signaling pathway; transcription initiation; negative regulation of protein kinase activity; spermine transport; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of histone acetylation