Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TAF7 rabbit polyclonal antibody. Western Blot analysis of TAF7 expression in HeLa.)

Rabbit anti-Human TAF7 Polyclonal Antibody | anti-TAF7 antibody

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (FITC)

Gene Names
TAF7; TAF2F; TAFII55
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF7; Polyclonal Antibody; TAF7 (TAF2F; TAFII55; Transcription Initiation Factor TFIID Subunit 7; RNA Polymerase II TBP-associated Factor Subunit F; Transcription Initiation Factor TFIID 55kD Subunit; TAF(II)55; TAFII-55) (FITC); anti-TAF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TAF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-TAF7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TAF7, aa1-349 (NP_005633.2).
Immunogen Sequence
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TAF7 rabbit polyclonal antibody. Western Blot analysis of TAF7 expression in HeLa.)

Western Blot (WB) (TAF7 rabbit polyclonal antibody. Western Blot analysis of TAF7 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 polyclonal antibody.)

Western Blot (WB) (Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 polyclonal antibody.)
Related Product Information for anti-TAF7 antibody
The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
Product Categories/Family for anti-TAF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,259 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 7
NCBI Official Synonym Full Names
TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
NCBI Official Symbol
TAF7
NCBI Official Synonym Symbols
TAF2F; TAFII55
NCBI Protein Information
transcription initiation factor TFIID subunit 7; TAFII-55; TAF(II)55; TBP-associated factor F; transcription factor IID subunit TAFII55; RNA polymerase II TBP-associated factor subunit F; transcription initiation factor TFIID 55 kDa subunit; transcription
UniProt Protein Name
Transcription initiation factor TFIID subunit 7
UniProt Gene Name
TAF7
UniProt Synonym Gene Names
TAF2F; TAFII55; TAF(II)55; TAFII-55; TAFII55
UniProt Entry Name
TAF7_HUMAN

NCBI Description

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF7: Functions as a component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. Present in both of the previously described TFIID species which either lack or contain TAFII30 (TFIID alpha and TFIID beta respectively). Belongs to the TAF7 family.

Protein type: DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; Golgi apparatus; transcription factor TFIID complex; transcription elongation factor complex b

Molecular Function: histone acetyltransferase binding; protein binding; vitamin D receptor binding; transcription coactivator activity; thyroid hormone receptor binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; estrogen receptor signaling pathway; transcription initiation; negative regulation of protein kinase activity; spermine transport; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of histone acetylation

Research Articles on TAF7

Similar Products

Product Notes

The TAF7 taf7 (Catalog #AAA6395953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF7 taf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.