Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TAF15 expression in transfected 293T cell line by TAF15 polyclonal antibody. Lane 1: TAF15 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human TAF15 Polyclonal Antibody | anti-TAF15 antibody

TAF15 (RBP56, TAF2N, TATA-binding Protein-associated Factor 2N, 68kD TATA-binding Protein-associated Factor, RNA-binding Protein 56, TAF(II)68, TAFII68) (Biotin)

Gene Names
TAF15; Npl3; RBP56; TAF2N; TAFII68
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF15; Polyclonal Antibody; TAF15 (RBP56; TAF2N; TATA-binding Protein-associated Factor 2N; 68kD TATA-binding Protein-associated Factor; RNA-binding Protein 56; TAF(II)68; TAFII68) (Biotin); anti-TAF15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TAF15.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TAF15 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TAF15, aa1-592 (NP_631961.1).
Immunogen Sequence
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TAF15 expression in transfected 293T cell line by TAF15 polyclonal antibody. Lane 1: TAF15 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TAF15 expression in transfected 293T cell line by TAF15 polyclonal antibody. Lane 1: TAF15 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(TAF15 rabbit polyclonal antibody. Western Blot analysis of TAF15 expression in human pancreas.)

Western Blot (WB) (TAF15 rabbit polyclonal antibody. Western Blot analysis of TAF15 expression in human pancreas.)
Related Product Information for anti-TAF15 antibody
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a subunit of TFIID present in a subset of TFIID complexes. Translocations involving chromosome 17 and chromosome 9, where the gene for the nuclear receptor CSMF is located, result in a gene fusion product that is an RNA binding protein associated with a subset of extraskeletal myxoid chondrosarcomas. Two transcripts encoding different isoforms have been identified.
Product Categories/Family for anti-TAF15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,830 Da
NCBI Official Full Name
TATA-binding protein-associated factor 2N isoform 1
NCBI Official Synonym Full Names
TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
NCBI Official Symbol
TAF15
NCBI Official Synonym Symbols
Npl3; RBP56; TAF2N; TAFII68
NCBI Protein Information
TATA-binding protein-associated factor 2N; RBP56/CSMF fusion; TBP-associated factor 15; TATA box-binding protein-associated factor 2N (RNA-binding protein 56); TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding prote
UniProt Protein Name
TATA-binding protein-associated factor 2N
UniProt Gene Name
TAF15
UniProt Synonym Gene Names
RBP56; TAF2N; TAF(II)68; TAFII68
UniProt Entry Name
RBP56_HUMAN

Uniprot Description

TAF15: RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II). A chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with NR4A3. Belongs to the RRM TET family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation; Oncoprotein; RNA-binding

Chromosomal Location of Human Ortholog: 17q11.1-q11.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; nucleotide binding

Biological Process: positive regulation of transcription, DNA-dependent

Disease: Chondrosarcoma, Extraskeletal Myxoid

Similar Products

Product Notes

The TAF15 taf15 (Catalog #AAA6395886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF15 (RBP56, TAF2N, TATA-binding Protein-associated Factor 2N, 68kD TATA-binding Protein-associated Factor, RNA-binding Protein 56, TAF(II)68, TAFII68) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF15 taf15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.