Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of STK11 expression in transfected 293T cell line by STK11 polyclonal antibody. Lane 1: STK11 transfected lysate (48.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human STK11 Polyclonal Antibody | anti-STK11 antibody

STK11 (Serine/Threonine Kinase 11, LKB1, PJS, Renal Carcinoma Antigen NY-REN-19, Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1) (AP)

Gene Names
STK11; PJS; LKB1; hLKB1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
STK11; Polyclonal Antibody; STK11 (Serine/Threonine Kinase 11; LKB1; PJS; Renal Carcinoma Antigen NY-REN-19; Serine/Threonine-protein Kinase 11; Serine/Threonine-protein Kinase LKB1) (AP); anti-STK11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STK11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-STK11 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human STK11, aa1-433 (NP_000446.1).
Immunogen Sequence
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of STK11 expression in transfected 293T cell line by STK11 polyclonal antibody. Lane 1: STK11 transfected lysate (48.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STK11 expression in transfected 293T cell line by STK11 polyclonal antibody. Lane 1: STK11 transfected lysate (48.6kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified rabbit antibody to STK11 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified rabbit antibody to STK11 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and PRKAA2 HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and PRKAA2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between STK11 and PRKAA2 HeLa cells were stained with STK11 rabbit purified polyclonal 1:1200 and PRKAA2 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Product Categories/Family for anti-STK11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,636 Da
NCBI Official Full Name
serine/threonine-protein kinase STK11
NCBI Official Synonym Full Names
serine/threonine kinase 11
NCBI Official Symbol
STK11
NCBI Official Synonym Symbols
PJS; LKB1; hLKB1
NCBI Protein Information
serine/threonine-protein kinase STK11; liver kinase B1; polarization-related protein LKB1; renal carcinoma antigen NY-REN-19; serine/threonine-protein kinase 11; serine/threonine-protein kinase LKB1
UniProt Protein Name
Serine/threonine-protein kinase STK11
UniProt Gene Name
STK11
UniProt Synonym Gene Names
LKB1; PJS; LKB1; hLKB1
UniProt Entry Name
STK11_HUMAN

NCBI Description

This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

LKB1: a S/T protein kinase of the CAMKL family. A tumor suppressor that helps control cell structure, polarity, apoptosis and energy homeostasis. Phosphorylates AGS3 (activator of G-protein signaling 3) GPR domains, regulating the interaction of GPR-containing proteins with G-proteins. A cytosolic protein complex comprised of LKB1, the pseudokinase STRAD, and the MO25 scaffold protein. Activates AMPK and several related protein kinases. AMPK plays a predominant role as the master regulator of cellular energy homeostasis, controlling downstream effectors that regulate cell growth and apoptosis in response to cellular ATP concentrations. The Lkb1/Strad/Mo25 complex can polarize single epithelial cells, leading to the formation of a brush border containing microvilli on the apical surface. Mutation in the corresponding gene causes Peutz-Jeghers syndrome (PJS), an autosomal dominant disorder characterized by benign GI tract polyps and dark skin lesions of the mouth, hands and feet. A variety of other LKB1 gene mutations have been associated with the formation of sporadic cancers in several tissues.

Protein type: Protein kinase, CAMK; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Autophagy; Tumor suppressor; CAMK group; CAMKL family; LKB subfamily

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: mitochondrion; membrane; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; p53 binding; magnesium ion binding; protein complex binding; protein kinase activator activity; ATP binding; LRR domain binding

Biological Process: Golgi localization; response to glucagon stimulus; protein heterooligomerization; protein amino acid autophosphorylation; Wnt receptor signaling pathway through beta-catenin; response to lipid; glucose homeostasis; T cell receptor signaling pathway; protein amino acid phosphorylation; anoikis; negative regulation of cell proliferation; positive regulation of gluconeogenesis; regulation of fatty acid biosynthetic process; vasculature development; tissue homeostasis; regulation of cell growth; cell cycle arrest; positive thymic T cell selection; regulation of Wnt receptor signaling pathway; positive regulation of transforming growth factor beta receptor signaling pathway; regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; axonogenesis; establishment of cell polarity; insulin receptor signaling pathway; activation of protein kinase activity; energy reserve metabolic process; autophagy; positive regulation of axonogenesis; negative regulation of cell growth; response to ionizing radiation; response to DNA damage stimulus; spermatid development

Disease: Pancreatic Cancer; Testicular Germ Cell Tumor; Peutz-jeghers Syndrome

Research Articles on STK11

Similar Products

Product Notes

The STK11 stk11 (Catalog #AAA6395334) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK11 (Serine/Threonine Kinase 11, LKB1, PJS, Renal Carcinoma Antigen NY-REN-19, Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STK11 stk11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STK11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.