Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse POFUT1 Polyclonal Antibody | anti-POFUT1 antibody

POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (MaxLight 650)

Gene Names
POFUT1; DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POFUT1; Polyclonal Antibody; POFUT1 (GDP-fucose Protein O-fucosyltransferase 1; Peptide-O-fucosyltransferase 1; O-FucT-1; FUT12; KIAA0180; MGC2482) (MaxLight 650); anti-POFUT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human POFUT1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
194
Applicable Applications for anti-POFUT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human POFUT1, aa1-194 (NP_758436.1).
Immunogen Sequence
MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-POFUT1 antibody
This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq].
Product Categories/Family for anti-POFUT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
GDP-fucose protein O-fucosyltransferase 1 isoform 2
NCBI Official Synonym Full Names
protein O-fucosyltransferase 1
NCBI Official Symbol
POFUT1
NCBI Official Synonym Symbols
DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1
NCBI Protein Information
GDP-fucose protein O-fucosyltransferase 1
UniProt Protein Name
GDP-fucose protein O-fucosyltransferase 1
UniProt Gene Name
POFUT1
UniProt Synonym Gene Names
FUT12; KIAA0180; O-FucT-1
UniProt Entry Name
OFUT1_HUMAN

NCBI Description

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

POFUT1: Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains. Plays a crucial role in Notch signaling. Belongs to the glycosyltransferase 68 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.1.221; Transferase

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: membrane; endoplasmic reticulum

Molecular Function: peptide-O-fucosyltransferase activity; fucosyltransferase activity

Biological Process: fucose metabolic process; nervous system development; protein amino acid O-linked glycosylation; somitogenesis; embryonic development; Notch signaling pathway; regulation of transcription, DNA-dependent; O-glycan processing; heart development; angiogenesis

Disease: Dowling-degos Disease 2

Research Articles on POFUT1

Similar Products

Product Notes

The POFUT1 pofut1 (Catalog #AAA6390051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (MaxLight 650) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's POFUT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POFUT1 pofut1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POFUT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.