Mouse anti-Human POFUT1 Monoclonal Antibody | anti-POFUT1 antibody

POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) APC

Cat. Num. AAA6138338

• Gene Names: POFUT1; DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POFUT1; Monoclonal Antibody; POFUT1 (GDP-fucose Protein O-fucosyltransferase 1; Peptide-O-fucosyltransferase 1; O-FucT-1; FUT12; KIAA0180; MGC2482) APC; anti-POFUT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H1
• Specificity: Recognizes human POFUT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 194

• Applicable Applications for anti-POFUT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa85-195 from POFUT1 (NP_758436) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Related Product Information for anti-POFUT1 antibody

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq].

Product Categories/Family for anti-POFUT1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 27436891
• NCBI GeneID: 23509
• NCBI Accession #: NP_758436
• NCBI GenBank Nucleotide #: NM_172236
• UniProt Accession #: Q9H488
• NCBI Official Full Name: GDP-fucose protein O-fucosyltransferase 1 isoform 2
• NCBI Official Synonym Full Names: protein O-fucosyltransferase 1
• NCBI Official Symbol: POFUT1
• NCBI Official Synonym Symbols: DDD2; FUT12; O-FUT; OFUCT1; O-Fuc-T; O-FucT-1
• NCBI Protein Information: GDP-fucose protein O-fucosyltransferase 1
• UniProt Protein Name: GDP-fucose protein O-fucosyltransferase 1
• UniProt Gene Name: POFUT1
• UniProt Synonym Gene Names: FUT12; KIAA0180; O-FucT-1
• UniProt Entry Name: OFUT1_HUMAN

NCBI Description

This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

POFUT1: Catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains. Plays a crucial role in Notch signaling. Belongs to the glycosyltransferase 68 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.1.221; Transferase

Chromosomal Location of Human Ortholog: 20q11

Cellular Component: membrane; endoplasmic reticulum

Molecular Function: peptide-O-fucosyltransferase activity; fucosyltransferase activity

Biological Process: fucose metabolic process; nervous system development; protein amino acid O-linked glycosylation; somitogenesis; embryonic development; Notch signaling pathway; regulation of transcription, DNA-dependent; O-glycan processing; heart development; angiogenesis

Disease: Dowling-degos Disease 2