Rabbit anti-Human, Mouse NNMT Polyclonal Antibody | anti-NNMT antibody

NNMT (Nicotinamide N-methyltransferase) (PE)

Cat. Num. AAA6387204

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NNMT; Polyclonal Antibody; NNMT (Nicotinamide N-methyltransferase) (PE); anti-NNMT antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NNMT. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-NNMT antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NNMT, aa1-264 (NP_006160.1).
• Immunogen Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(NNMT rabbit polyclonal antibody. Western Blot analysis of NNMT expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of NNMT expression in transfected 293T cell line by NNMT polyclonal antibody. Lane 1: NNMT transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NNMT antibody

Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.

Product Categories/Family for anti-NNMT antibody

Antibodies; Enzymes; Methyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 5453790
• NCBI GeneID: 4837
• NCBI Accession #: NP_006160.1
• NCBI GenBank Nucleotide #: NM_006169.2
• UniProt Accession #: P40261
• Molecular Weight: 29,574 Da
• NCBI Official Full Name: nicotinamide N-methyltransferase
• NCBI Official Synonym Full Names: nicotinamide N-methyltransferase
• NCBI Official Symbol: NNMT
• NCBI Protein Information: nicotinamide N-methyltransferase
• UniProt Protein Name: Nicotinamide N-methyltransferase
• UniProt Gene Name: NNMT
• UniProt Entry Name: NNMT_HUMAN

NCBI Description

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 2008]

Uniprot Description

NNMT: Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds. Belongs to the NNMT/PNMT/TEMT family.

Protein type: Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.1.1.1; Methyltransferase

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: cytosol

Molecular Function: nicotinamide N-methyltransferase activity

Biological Process: response to drug; methylation; organ regeneration; xenobiotic metabolic process; response to organic nitrogen