Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (54.78kD).)

Mouse anti-Human NNMT Monoclonal Antibody | anti-NNMT antibody

NNMT (Nicotinamide N-methyltransferase) (AP)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NNMT; Monoclonal Antibody; NNMT (Nicotinamide N-methyltransferase) (AP); anti-NNMT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F2
Specificity
Recognizes human NNMT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NNMT antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-265 from human NNMT (AAH00234) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (54.78kD).)

Western Blot (WB) (Western Blot detection against Immunogen (54.78kD).)

Western Blot (WB)

(Western Blot analysis of NNMT expression in transfected 293T cell line by NNMT monoclonal antibody. Lane 1: NNMT transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NNMT expression in transfected 293T cell line by NNMT monoclonal antibody. Lane 1: NNMT transfected lysate (29.6kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NNMT transfected lysate using NNMT monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NNMT rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NNMT transfected lysate using NNMT monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NNMT rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged NNMT is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NNMT is ~1ng/ml as a capture antibody.)
Related Product Information for anti-NNMT antibody
Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds.
Product Categories/Family for anti-NNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,574 Da
NCBI Official Full Name
Homo sapiens nicotinamide N-methyltransferase, mRNA
NCBI Official Synonym Full Names
nicotinamide N-methyltransferase
NCBI Official Symbol
NNMT
NCBI Protein Information
nicotinamide N-methyltransferase

NCBI Description

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq, Jul 2008]

Research Articles on NNMT

Similar Products

Product Notes

The NNMT (Catalog #AAA6132606) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NNMT (Nicotinamide N-methyltransferase) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NNMT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NNMT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NNMT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.