Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Fig-1: Detection of human ICOSL in the CHO-K1/ICOSL stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/ICOSL cells (Red).)

ICOSL cell line

ICOSL Stable Cell Line

Gene Names
ICOSLG; B7H2; GL50; B7-H2; B7RP1; CD275; ICOSL; LICOS; B7RP-1; ICOS-L
Applications
Flow Cytometry, Immunocytochemistry
Synonyms
ICOSL; ICOSL Stable Cell Line; ICOSL cell line
Ordering
For Research Use Only!
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence Positions
hICOSL (accession number NM_015259)
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG HV
Applicable Applications for ICOSL cell line
Screen for antibodies of human ICOSL through Flow Cytometry, Immunocytochemistry or Western blotting
Application Notes
Screen for antibodies of human ICOSL through Flow Cytometry, Immun degree Cyt degree Chemistry or Western blotting. Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C-CO2 incubator. Leave the T25 flask in the incubator for 2~3 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1: 10 to 1: 20 weekly.
Culture conditions
Cells should be grown at 37°C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ?g/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completelyrecover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Shipping Note
Product available only in the USA.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.

Testing Data

(Fig-1: Detection of human ICOSL in the CHO-K1/ICOSL stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/ICOSL cells (Red).)

Testing Data (Fig-1: Detection of human ICOSL in the CHO-K1/ICOSL stable cell line by Flow Cytometry. CHO-K1 cells (Green); CHO-K1/ICOSL cells (Red).)
Related Product Information for ICOSL cell line
ICOSL Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human ICOS Ligand (ICOSL, also known as B7-H2, B7RP-1, and CD275).
Product Categories/Family for ICOSL cell line

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ICOS ligand isoform d
NCBI Official Synonym Full Names
inducible T-cell costimulator ligand
NCBI Official Symbol
ICOSLG
NCBI Official Synonym Symbols
B7H2; GL50; B7-H2; B7RP1; CD275; ICOSL; LICOS; B7RP-1; ICOS-L
NCBI Protein Information
ICOS ligand
UniProt Protein Name
ICOS ligand
UniProt Gene Name
ICOSLG
UniProt Synonym Gene Names
B7H2; B7RP1; ICOSL; KIAA0653; B7-H2; B7RP-1

Uniprot Description

ICOSLG: Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co- stimulating memory T-cell function. Belongs to the immunoglobulin superfamily. BTN/MOG family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: plasma membrane

Molecular Function: receptor binding

Biological Process: positive regulation of activated T cell proliferation; T cell costimulation

Research Articles on ICOSL

Similar Products

Product Notes

The ICOSL icoslg (Catalog #AAA668855) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is hICOSL (accession number NM_015259). AAA Biotech's ICOSL can be used in a range of immunoassay formats including, but not limited to, Screen for antibodies of human ICOSL through Flow Cytometry, Immunocytochemistry or Western blotting. Screen for antibodies of human ICOSL through Flow Cytometry, Immun degree Cyt degree Chemistry or Western blotting. Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C-CO2 incubator. Leave the T25 flask in the incubator for 2~3 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1: 10 to 1: 20 weekly. Researchers should empirically determine the suitability of the ICOSL icoslg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRLGSPGLLF LLFSSLRADT QEKEVRAMVG SDVELSCACP EGSRFDLNDV YVYWQTSESK TVVTYHIP QNSSLENVDS RYRNRALMSP AGMLRGDFSL RLFNVTPQDE QKFHCLVLSQ SL GFQEVL SVEVTLHVAA NFSVPVVSAP HSPSQDELTF TCTSINGYPR PNVYWINKTD NSLL DQAL QNDTVFLNMR GLYDVVSVLR IARTPSVNIG CCIENVLLQQ NLTVGSQTGN DIGERD KI TENPVSTGEK NAATWSILAV LCLLVVVAVA IGWVCRDRCL QHSYAGAWAV SPETELTG HV. It is sometimes possible for the material contained within the vial of "ICOSL, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.