Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human HBXIP Polyclonal Antibody | anti-HBXIP antibody

HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (MaxLight 750)

Gene Names
LAMTOR5; XIP; HBXIP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HBXIP; Polyclonal Antibody; HBXIP (LAMTOR5; Ragulator Complex Protein LAMTOR5; Hepatitis B Virus X-interacting Protein; HBV X-interacting Protein; HBX-interacting Protein; Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5; XIP) (MaxLight 750); anti-HBXIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HBXIP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-HBXIP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length protein corresponding to aa1-173 from human HBXIP (NP_006393.2).
Immunogen Sequence
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HBXIP antibody
As part of the Ragulator complex it is involved in aa sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by aa through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.
Product Categories/Family for anti-HBXIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
ragulator complex protein LAMTOR5
NCBI Official Synonym Full Names
late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
NCBI Official Symbol
LAMTOR5
NCBI Official Synonym Symbols
XIP; HBXIP
NCBI Protein Information
ragulator complex protein LAMTOR5; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x interacting protein; hepatitis B virus x-interacting protein (9.6kD); late endosomal/lysosomal adaptor and MAPK and MTOR activator 5
UniProt Protein Name
Ragulator complex protein LAMTOR5
UniProt Gene Name
LAMTOR5
UniProt Synonym Gene Names
HBXIP; XIP; HBV X-interacting protein
UniProt Entry Name
LTOR5_HUMAN

Similar Products

Product Notes

The HBXIP lamtor5 (Catalog #AAA6380823) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HBXIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HBXIP lamtor5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HBXIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.