Rabbit anti-Human HBXIP Polyclonal Antibody | anti-LAMTOR5 antibody

HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP)

Cat. Num. AAA6009920

• Gene Names: LAMTOR5; XIP; HBXIP
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: HBXIP; Polyclonal Antibody; HBXIP (LAMTOR5; Ragulator Complex Protein LAMTOR5; Hepatitis B Virus X-interacting Protein; HBV X-interacting Protein; HBX-interacting Protein; Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5; XIP); Anti -HBXIP (LAMTOR5; anti-LAMTOR5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human HBXIP.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

• Applicable Applications for anti-LAMTOR5 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full-length human HBXIP, aa1-173 (NP_006393.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HBXIP expression in transfected 293T cell line using MBS6009920 Lane 1: HBXIP transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LAMTOR5 antibody

As part of the Ragulator complex it is involved in aa sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by aa through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.

Product Categories/Family for anti-LAMTOR5 antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 49457256
• NCBI GeneID: 10542
• UniProt Accession #: O43504; Q6IBD8
• Molecular Weight: 9,614 Da
• NCBI Official Full Name: HBXIP
• NCBI Official Synonym Full Names: late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
• NCBI Official Symbol: LAMTOR5
• NCBI Official Synonym Symbols: XIP; HBXIP
• NCBI Protein Information: ragulator complex protein LAMTOR5; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x interacting protein; hepatitis B virus x-interacting protein (9.6kD); late endosomal/lysosomal adaptor and MAPK and MTOR activator 5
• UniProt Protein Name: Ragulator complex protein LAMTOR5
• Protein Family: Ragulator complex protein
• UniProt Gene Name: LAMTOR5
• UniProt Synonym Gene Names: HBXIP; XIP; HBV X-interacting protein
• UniProt Entry Name: LTOR5_HUMAN

NCBI Description

This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 2008]

Uniprot Description

HBXIP: When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication. Belongs to the HBXIP family.

Protein type: DNA replication; Apoptosis

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: lysosome; cytosol

Molecular Function: protein binding; guanyl-nucleotide exchange factor activity; protein complex scaffold

Biological Process: response to virus; viral genome replication; negative regulation of caspase activity; regulation of cell size; positive regulation of TOR signaling pathway; negative regulation of apoptosis; positive regulation of GTPase activity