Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FKBP3 rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.)

Rabbit anti-Human FKBP3 Polyclonal Antibody | anti-FKBP3 antibody

FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (PE)

Gene Names
FKBP3; FKBP-3; FKBP25; PPIase; FKBP-25
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP3; Polyclonal Antibody; FKBP3 (FK506-binding Protein 3; Peptidyl-prolyl Cis-trans Isomerase FKBP3; PPIase FKBP3; Rotamase; 25kD FKBP; FKBP-25; 25kD FK506-binding Protein; Rapamycin-selective 25kD Immunophilin; FKBP25) (PE); anti-FKBP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FKBP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FKBP3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FKBP3, aa1-224 (NP_002004.1).
Immunogen Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FKBP3 rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.)

Western Blot (WB) (FKBP3 rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of FKBP3 expression in transfected 293T cell line by FKBP3 polyclonal antibody. Lane 1: FKBP3 transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FKBP3 expression in transfected 293T cell line by FKBP3 polyclonal antibody. Lane 1: FKBP3 transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FKBP3 antibody
FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.
Product Categories/Family for anti-FKBP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,177 Da
NCBI Official Full Name
Homo sapiens FK506 binding protein 3, 25kDa (FKBP3), mRNA
NCBI Official Synonym Full Names
FK506 binding protein 3, 25kDa
NCBI Official Symbol
FKBP3
NCBI Official Synonym Symbols
FKBP-3; FKBP25; PPIase; FKBP-25
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP3; 25 kDa FK506-binding protein; 25 kDa FKBP; FK506-binding protein 25, T-cell; FK506-binding protein 3 (25kD); PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; rapamycin-selective 25 kDa immunophilin;
Protein Family

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008]

Research Articles on FKBP3

Similar Products

Product Notes

The FKBP3 (Catalog #AAA6378657) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP3 (FK506-binding Protein 3, Peptidyl-prolyl Cis-trans Isomerase FKBP3, PPIase FKBP3, Rotamase, 25kD FKBP, FKBP-25, 25kD FK506-binding Protein, Rapamycin-selective 25kD Immunophilin, FKBP25) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.