Melanoma Inhibitory Activity Protein Active Protein | MIA2 active protein
Melanoma Inhibitory Activity Protein, Recombinant, Human (MIA)
Purity
Highly Purified95% by RP-HPLC or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified.
Synonyms
Melanoma Inhibitory Activity Protein; Recombinant; Human (MIA); MIA2 active protein
Host
E Coli
Purity/Purification
Highly Purified
95% by RP-HPLC or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified.
95% by RP-HPLC or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified.
Form/Format
Supplied as a lyophilized powder from 20mM potassium phosphate, pH 7.0, 150mM potassium chloride.
Sequence
Agrees with the sequence of native human MIA with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ
Biological Activity
The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor Cells and found active in Mel In assay.
Protein Content
UV spectroscopy at 280nm using the absorbption coefficient of 19300 M-1cm-1.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C.. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for MIA2 active protein
MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors, including gliomas, in an autocrine fashion. In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful for staging of primary melanomas, detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.
Recombinant Human MIA is a single, non-glycosylated, polypeptide chain consisting of 108aa having a total molecular mass of 12237 Dalton. The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain.
Recombinant Human MIA is a single, non-glycosylated, polypeptide chain consisting of 108aa having a total molecular mass of 12237 Dalton. The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain.
Product Categories/Family for MIA2 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,771 Da
NCBI Official Full Name
melanoma inhibitory activity protein 2
NCBI Official Synonym Full Names
melanoma inhibitory activity 2
NCBI Official Symbol
MIA2
NCBI Protein Information
melanoma inhibitory activity protein 2
UniProt Protein Name
Melanoma inhibitory activity protein 2
Protein Family
UniProt Gene Name
MIA2
UniProt Entry Name
MIA2_HUMAN
Uniprot Description
MIA2: May play a role in the pathophysiology of liver disease and may serve as a marker of liver damage. Belongs to the MIA/OTOR family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 14q13.2
Cellular Component: extracellular region
Biological Process: cholesterol homeostasis
Research Articles on MIA2
Similar Products
Product Notes
The MIA2 mia2 (Catalog #AAA637470) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: Agrees with the sequence of native human MIA with an addition N-terminal Methionine residue. MGPMPKLADR KLCADQECSS HPISMAVALQ DYMAPDCRFL TIHRGQVVYV FSLKGRGRFL WGGSVQGDYY GDLAARLGYF PSSIVREDQT LKVDVKTDKW DFYCQ. It is sometimes possible for the material contained within the vial of "Melanoma Inhibitory Activity Protein, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
