Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CECR1 expression in transfected 293T cell line byMBS648602. Lane 1: CECR1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CECR1 Polyclonal Antibody | anti-CECR1 antibody

CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) APC

Gene Names
ADA2; PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CECR1; Polyclonal Antibody; CECR1 (Adenosine Deaminase CECR1; Cat Eye Syndrome Critical Region Protein 1; ADA2; ADGF; IDGFL) APC; anti-CECR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CECR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
270
Applicable Applications for anti-CECR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CECR1, aa1-270 (NP_803124.1).
Immunogen Sequence
MDSLEWNWALVYELSGEHHDEEWSVKTYQEVAQKFVETHPEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEALMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CECR1 expression in transfected 293T cell line byMBS648602. Lane 1: CECR1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CECR1 expression in transfected 293T cell line byMBS648602. Lane 1: CECR1 transfected lysate (30.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CECR1 antibody
Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
Product Categories/Family for anti-CECR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
adenosine deaminase 2 isoform b
NCBI Official Synonym Full Names
adenosine deaminase 2
NCBI Official Symbol
ADA2
NCBI Official Synonym Symbols
PAN; ADGF; CECR1; IDGFL; SNEDS; VAIHS
NCBI Protein Information
adenosine deaminase 2
UniProt Protein Name
Adenosine deaminase CECR1
Protein Family
UniProt Gene Name
CECR1
UniProt Synonym Gene Names
ADA2; ADGF; IDGFL

NCBI Description

This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein is one of two adenosine deaminases found in humans, which regulate levels of the signaling molecule, adenosine. The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

CECR1: Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity. Belongs to the adenosine and AMP deaminases family. ADGF subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.4.4; Hydrolase; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q11.1

Cellular Component: cytosol; extracellular region; extracellular space

Molecular Function: adenosine deaminase activity; adenosine receptor binding; growth factor activity; protein homodimerization activity; proteoglycan binding; zinc ion binding

Biological Process: adenosine catabolic process; cellular protein metabolic process; hypoxanthine salvage; inosine biosynthetic process

Disease: Polyarteritis Nodosa, Childhood-onset; Sneddon Syndrome

Research Articles on CECR1

Similar Products

Product Notes

The CECR1 cecr1 (Catalog #AAA6373621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CECR1 (Adenosine Deaminase CECR1, Cat Eye Syndrome Critical Region Protein 1, ADA2, ADGF, IDGFL) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CECR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CECR1 cecr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CECR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.