Western Blot (WB)
(WB Suggested Anti-ZNF426 AntibodyTitration: 2.5 ug/mlPositive Control: Fetal Liver)
Rabbit ZNF426 Polyclonal Antibody | anti-ZNF426 antibody
ZNF426 antibody - N-terminal region
Gene Names
ZNF426; K-RBP
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZNF426; Polyclonal Antibody; ZNF426 antibody - N-terminal region; anti-ZNF426 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS
Sequence Length
554
Applicable Applications for anti-ZNF426 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF426
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF426 AntibodyTitration: 2.5 ug/mlPositive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-ZNF426 AntibodyTitration: 2.5 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-ZNF426 antibody
This is a rabbit polyclonal antibody against ZNF426. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF426 gene located on chromosome 19.
Target Description: ZNF426 gene located on chromosome 19.
Product Categories/Family for anti-ZNF426 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
zinc finger protein 426 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 426
NCBI Official Symbol
ZNF426
NCBI Official Synonym Symbols
K-RBP
NCBI Protein Information
zinc finger protein 426
UniProt Protein Name
Zinc finger protein 426
Protein Family
UniProt Gene Name
ZNF426
UniProt Entry Name
ZN426_HUMAN
NCBI Description
Kaposi's sarcoma-associated herpesvirus (KSHV) can be reactivated from latency by the viral protein RTA. The protein encoded by this gene is a zinc finger transcriptional repressor that interacts with RTA to modulate RTA-mediated reactivation of KSHV. While the encoded protein can repress KSHV reactivation, RTA can induce degradation of this protein through the ubiquitin-proteasome pathway to overcome the repression. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Uniprot Description
Function: May be involved in transcriptional regulation.
Subcellular location: Nucleus
Potential.
Sequence similarities: Contains 12 C2H2-type zinc fingers.Contains 1 KRAB domain.
Research Articles on ZNF426
Similar Products
Product Notes
The ZNF426 znf426 (Catalog #AAA3201602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF426 antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF426 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF426 znf426 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMLENYKNLA TVGGQIIKPS LISWLEQEES RTVQGGVLQG WEMRLETQWS. It is sometimes possible for the material contained within the vial of "ZNF426, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
