Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD8B expression in transfected 293T cell line by CD8B polyclonal antibody. Lane 1: CD8B transfected lysate (27.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CD8B Polyclonal Antibody | anti-CD8B antibody

CD8B (T-cell Surface Glycoprotein CD8 beta Chain, CD8b, CD8B1) (FITC)

Gene Names
CD8B; LY3; P37; LEU2; LYT3; CD8B1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD8B; Polyclonal Antibody; CD8B (T-cell Surface Glycoprotein CD8 beta Chain; CD8b; CD8B1) (FITC); anti-CD8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD8B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
243
Applicable Applications for anti-CD8B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD8B, aa1-243 (NP_757362.1).
Immunogen Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD8B expression in transfected 293T cell line by CD8B polyclonal antibody. Lane 1: CD8B transfected lysate (27.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD8B expression in transfected 293T cell line by CD8B polyclonal antibody. Lane 1: CD8B transfected lysate (27.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD8B antibody
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.
Product Categories/Family for anti-CD8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
926
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
T-cell surface glycoprotein CD8 beta chain isoform 2
NCBI Official Synonym Full Names
CD8b molecule
NCBI Official Symbol
CD8B
NCBI Official Synonym Symbols
LY3; P37; LEU2; LYT3; CD8B1
NCBI Protein Information
T-cell surface glycoprotein CD8 beta chain
UniProt Protein Name
T-cell surface glycoprotein CD8 beta chain
UniProt Gene Name
CD8B
UniProt Synonym Gene Names
CD8B1
UniProt Entry Name
CD8B_HUMAN

NCBI Description

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq, May 2010]

Uniprot Description

CD8B: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: T cell receptor complex; integral to plasma membrane; early endosome membrane; plasma membrane; extracellular region; external side of plasma membrane

Molecular Function: protein binding; MHC class I protein binding; coreceptor activity

Biological Process: regulation of immune response; T cell activation; viral reproduction; immune response; regulation of defense response to virus by virus; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on CD8B

Similar Products

Product Notes

The CD8B cd8b (Catalog #AAA6373326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD8B (T-cell Surface Glycoprotein CD8 beta Chain, CD8b, CD8B1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD8B cd8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.