Mouse anti-Human CD8B Monoclonal Antibody | anti-CD8B antibody

CD8B (T-cell Surface Glycoprotein CD8 beta Chain, CD8b, CD8B1) (Biotin)

Cat. Num. AAA6141086

• Gene Names: CD8B; LY3; P37; LEU2; LYT3; CD8B1
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD8B; Monoclonal Antibody; CD8B (T-cell Surface Glycoprotein CD8 beta Chain; CD8b; CD8B1) (Biotin); anti-CD8B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C8
• Specificity: Recognizes human CD8B1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CD8B antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa23-131 from human CD8B1 (NP_004922) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD8B is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CD8B antibody

Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing.

Product Categories/Family for anti-CD8B antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4826667
• NCBI GeneID: 926
• NCBI Accession #: NP_004922
• NCBI GenBank Nucleotide #: NM_004931
• UniProt Accession #: P10966; P14860; P14861; Q15980; Q496E0; Q496E1; Q496E2; Q9UDB4; Q9UDB5; Q9UDB6; Q9UDB7; Q9UDB8
• Molecular Weight: 19.2kDa (172aa)
• NCBI Official Full Name: T-cell surface glycoprotein CD8 beta chain isoform 5
• NCBI Official Synonym Full Names: CD8b molecule
• NCBI Official Symbol: CD8B
• NCBI Official Synonym Symbols: LY3; P37; LEU2; LYT3; CD8B1
• NCBI Protein Information: T-cell surface glycoprotein CD8 beta chain
• UniProt Protein Name: T-cell surface glycoprotein CD8 beta chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD8B
• UniProt Synonym Gene Names: CD8B1
• UniProt Entry Name: CD8B_HUMAN

NCBI Description

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified. [provided by RefSeq, May 2010]

Uniprot Description

CD8B: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: T cell receptor complex; integral to plasma membrane; early endosome membrane; plasma membrane; extracellular region; external side of plasma membrane

Molecular Function: protein binding; MHC class I protein binding; coreceptor activity

Biological Process: regulation of immune response; T cell activation; viral reproduction; immune response; regulation of defense response to virus by virus; transmembrane receptor protein tyrosine kinase signaling pathway