Western Blot (WB)
(WB Suggested Anti-PDXDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysatePDXDC1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit PDXDC1 Polyclonal Antibody | anti-PDXDC1 antibody
PDXDC1 antibody - N-terminal region
Gene Names
PDXDC1; LP8165
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDXDC1; Polyclonal Antibody; PDXDC1 antibody - N-terminal region; anti-PDXDC1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT
Sequence Length
788
Applicable Applications for anti-PDXDC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDXDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PDXDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysatePDXDC1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-PDXDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysatePDXDC1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-PDXDC1 antibody
This is a rabbit polyclonal antibody against PDXDC1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.
Target Description: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.
Product Categories/Family for anti-PDXDC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
pyridoxal-dependent decarboxylase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
pyridoxal dependent decarboxylase domain containing 1
NCBI Official Symbol
PDXDC1
NCBI Official Synonym Symbols
LP8165
NCBI Protein Information
pyridoxal-dependent decarboxylase domain-containing protein 1
UniProt Protein Name
Pyridoxal-dependent decarboxylase domain-containing protein 1
Protein Family
UniProt Gene Name
PDXDC1
UniProt Synonym Gene Names
KIAA0251
UniProt Entry Name
PDXD1_HUMAN
Uniprot Description
PDXDC1: Belongs to the group II decarboxylase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 4.1.1.-; Lyase
Chromosomal Location of Human Ortholog: 16p13.11
Cellular Component: Golgi apparatus; intracellular membrane-bound organelle
Molecular Function: carboxy-lyase activity; pyridoxal phosphate binding
Biological Process: carboxylic acid metabolic process
Research Articles on PDXDC1
Similar Products
Product Notes
The PDXDC1 pdxdc1 (Catalog #AAA3212079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDXDC1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDXDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDXDC1 pdxdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEDEEPQSPR IQNIGEQGHM ALLGHSLGAY ISTLDKEKLR KLTTRILSDT. It is sometimes possible for the material contained within the vial of "PDXDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
