Mouse anti-Human Cyclin D2 Monoclonal Antibody | anti-CCND2 antibody

Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) (HRP)

Cat. Num. AAA6152037

• Gene Names: CCND2; MPPH3; KIAK0002
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cyclin D2; Monoclonal Antibody; Cyclin D2 (CCND2; G1/S-specific Cyclin-D2; KIAK0002; MGC102758) (HRP); anti-CCND2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B10
• Specificity: Recognizes human CCND2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CCND2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa190-289 from human CCND2 (AAH10958) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 monoclonal antibody. Lane 1: CCND2 transfected lysate (33.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CCND2 antibody

Cyclins are proteins that regulate cell cycle progression by interacting with cdc2 kinase or related kinases. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. The D-type cyclins (D1, D2, and D3) are a family of cell cycle regulators involved in the G1/S phase transition of the cell cycle. On binding to cyclin-dependent kinases CDK4 or CDK6 and activation by a CDK-activating kinase complex, the cyclin-CDK complex activates numerous genes involved in DNA synthesis and cell cycle progression. Cyclin D2 a G1 cyclin, is a member of the family of D-type cyclins. Indirect immunofluorescence studies showed that the protein is localized to the nucleus in G0, suggesting a nuclear function for cyclin D2 in quiescent cells. It is found to be associated with the cyclin-dependent kinases, CDK2 and CDK4 and thus mediates the phosphorylation of tumor suppressor protein Rb during growth arrest. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation.

Product Categories/Family for anti-CCND2 antibody

Antibodies; Cyclin

NCBI and Uniprot Product Information

• NCBI GI #: 15012104
• NCBI GeneID: 894
• Molecular Weight: 24,461 Da
• NCBI Official Full Name: Homo sapiens cyclin D2, mRNA
• NCBI Official Synonym Full Names: cyclin D2
• NCBI Official Symbol: CCND2
• NCBI Official Synonym Symbols: MPPH3; KIAK0002
• NCBI Protein Information: G1/S-specific cyclin-D2
• Protein Family: G1/S-specific cyclin

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). [provided by RefSeq, Sep 2014]