Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CD62E Polyclonal Antibody | anti-CD62E antibody

CD62E (LECAM, E-Selectin, Endothelial Leukocyte Adhesion Molecule, CD62 Antigen-like Family Member E, Endothelial Leukocyte Adhesion Molecule 1, ELAM-1, Leukocyte-endothelial Cell Adhesion Molecule 2, LECAM2, SELE, ELAM1) (MaxLight 750)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD62E; Polyclonal Antibody; CD62E (LECAM; E-Selectin; Endothelial Leukocyte Adhesion Molecule; CD62 Antigen-like Family Member E; Endothelial Leukocyte Adhesion Molecule 1; ELAM-1; Leukocyte-endothelial Cell Adhesion Molecule 2; LECAM2; SELE; ELAM1) (MaxLight 750); anti-CD62E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SELE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
610
Applicable Applications for anti-CD62E antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SELE, aa1-610 (NP_000441.1)
Immunogen Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD62E antibody
CD62E is also known as ELAM-1, E-selectin and LECAM-2. CD62E binds to CD15s and thereby mediates neutrophil adhesion to endothelium. CD62E is expressed on activated endothelium and on chronically inflamed skin and synovial lesions. This antibody blocks skin homing human lymphocytes from binding to E-selectin transfected cells. This antibody also inhibits binding of human neutrophils and human myeloid cells (HL60 cell line) to IL-1 stimulated human umbilical vein endothelial cells and E-selectin transfected cells. CD62E is a member of a small family of proteins known as the selectins. Members of the selectin family are characterized by the presence of three homologous domains. Located at the N-terminus is the homologous calcium ion-dependent lectin related domain which mediates ligand binding. Adjacent to the lectin related domain is the homologous EGF-related domain. Between the EGFrelated domain and the cell membrane is the complement regulatory domain composed of repeats which bear homology with complement regulatory proteins (CRP's). Each of the selectins also possesses a transmembrane domain and a short cytoplasmic domain which corresponds to the C-terminus of the protein.
Product Categories/Family for anti-CD62E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
selectin E

Similar Products

Product Notes

The CD62E (Catalog #AAA6373211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD62E (LECAM, E-Selectin, Endothelial Leukocyte Adhesion Molecule, CD62 Antigen-like Family Member E, Endothelial Leukocyte Adhesion Molecule 1, ELAM-1, Leukocyte-endothelial Cell Adhesion Molecule 2, LECAM2, SELE, ELAM1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD62E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD62E for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD62E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.