Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human WDR36 Monoclonal Antibody | anti-WDR36 antibody

WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (MaxLight 750)

Gene Names
WDR36; GLC1G; UTP21; TAWDRP; TA-WDRP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WDR36; Monoclonal Antibody; WDR36 (WD Repeat-containing Protein 36; T-cell Activation WD Repeat-containing Protein; TAWDRP; TA-WDRP; GLC1G; UTP21) (MaxLight 750); anti-WDR36 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes human WDR36.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
951
Applicable Applications for anti-WDR36 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa853-952 from human WDR36 (NP_644810) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-WDR36 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-WDR36 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
WD repeat-containing protein 36
NCBI Official Synonym Full Names
WD repeat domain 36
NCBI Official Symbol
WDR36
NCBI Official Synonym Symbols
GLC1G; UTP21; TAWDRP; TA-WDRP
NCBI Protein Information
WD repeat-containing protein 36
UniProt Protein Name
WD repeat-containing protein 36
UniProt Gene Name
WDR36
UniProt Synonym Gene Names
TA-WDRP
UniProt Entry Name
WDR36_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Mutations in this gene have been associated with adult-onset primary open-angle glaucoma (POAG). [provided by RefSeq, Jul 2008]

Uniprot Description

WDR36: Involved in T-cell activation and highly co-regulated with IL2. Defects in WDR36 are the cause of primary open angle glaucoma type 1G (GLC1G). Primary open angle glaucoma (POAG) is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 5q22.1

Cellular Component: small subunit processome; nucleolus

Biological Process: retinal homeostasis; visual perception; response to stimulus; regulation of axon extension; rRNA processing

Disease: Glaucoma 1, Open Angle, G

Research Articles on WDR36

Similar Products

Product Notes

The WDR36 wdr36 (Catalog #AAA6236126) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR36 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WDR36 wdr36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WDR36, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.