Mouse anti-Human WDR36 Monoclonal Antibody | anti-WDR36 antibody

WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) APC

Cat. Num. AAA6139865

• Gene Names: WDR36; GLC1G; UTP21; TAWDRP; TA-WDRP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WDR36; Monoclonal Antibody; WDR36 (WD Repeat-containing Protein 36; T-cell Activation WD Repeat-containing Protein; TAWDRP; TA-WDRP; GLC1G; UTP21) APC; anti-WDR36 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D6
• Specificity: Recognizes human WDR36.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 951

• Applicable Applications for anti-WDR36 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa853-952 from human WDR36 (NP_644810) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged WDR36 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-WDR36 antibody

Antibodies; WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21281677
• NCBI GeneID: 134430
• NCBI Accession #: NP_644810
• NCBI GenBank Nucleotide #: NM_139281
• UniProt Accession #: Q8NI36
• NCBI Official Full Name: WD repeat-containing protein 36
• NCBI Official Synonym Full Names: WD repeat domain 36
• NCBI Official Symbol: WDR36
• NCBI Official Synonym Symbols: GLC1G; UTP21; TAWDRP; TA-WDRP
• NCBI Protein Information: WD repeat-containing protein 36
• UniProt Protein Name: WD repeat-containing protein 36
• Protein Family: WD repeat-containing protein
• UniProt Gene Name: WDR36
• UniProt Synonym Gene Names: TA-WDRP
• UniProt Entry Name: WDR36_HUMAN

NCBI Description

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Mutations in this gene have been associated with adult-onset primary open-angle glaucoma (POAG). [provided by RefSeq, Jul 2008]

Uniprot Description

WDR36: Involved in T-cell activation and highly co-regulated with IL2. Defects in WDR36 are the cause of primary open angle glaucoma type 1G (GLC1G). Primary open angle glaucoma (POAG) is characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 5q22.1

Cellular Component: small subunit processome; nucleolus

Biological Process: retinal homeostasis; visual perception; response to stimulus; regulation of axon extension; rRNA processing

Disease: Glaucoma 1, Open Angle, G