Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PCSK1N Monoclonal Antibody | anti-PCSK1N antibody

PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS) (MaxLight 550)

Gene Names
PCSK1N; PEN; SAAS; SCG8; BigLEN; SgVIII; PROSAAS
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCSK1N; Monoclonal Antibody; PCSK1N (ProSAAS; Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor; Proprotein Convertase 1 Inhibitor; pro-SAAS) (MaxLight 550); anti-PCSK1N antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E9
Specificity
Recognizes human PCSK1N.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PCSK1N antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa173-261 from human PCSK1N (NP_037403) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PCSK1N antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.6kDa (251aa)
NCBI Official Full Name
proSAAS preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 1 inhibitor
NCBI Official Symbol
PCSK1N
NCBI Official Synonym Symbols
PEN; SAAS; SCG8; BigLEN; SgVIII; PROSAAS
NCBI Protein Information
proSAAS
UniProt Protein Name
ProSAAS
Protein Family
UniProt Gene Name
PCSK1N
UniProt Synonym Gene Names
Proprotein convertase 1 inhibitor; b-SAAS; l-SAAS; b-PEN-LEN; l-LEN; b-LEN

NCBI Description

The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013]

Uniprot Description

May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known ().

Research Articles on PCSK1N

Similar Products

Product Notes

The PCSK1N pcsk1n (Catalog #AAA6213047) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCSK1N can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCSK1N pcsk1n for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCSK1N, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.