Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human CBS Monoclonal Antibody | anti-CBS antibody

CBS (Cystathionine beta-synthase, Serine Sulfhydrase, Beta-thionase) (MaxLight 550)

Gene Names
CBS; HIP4
Reactivity
Human
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CBS; Monoclonal Antibody; CBS (Cystathionine beta-synthase; Serine Sulfhydrase; Beta-thionase) (MaxLight 550); anti-CBS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E1
Specificity
Recognizes human CBS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CBS antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CBS (NP_000062) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-CBS antibody
References
1. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Dufton N, Natividad J, Verdu EF, Wallace JL.Sci Rep. 2012;2:499. Epub 2012 Jul 9. 2. Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine ?]-Synthase and Cystathionine ?^-Lyase, in Human Prostatic Tissue and Cells. Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J.Urology. 2012 Feb;79(2):483.e1-5. 3. Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao. Lu YH, Huang YH, Cheng LM, Yu HC, Hsu JH, Wu JT, Lo MY, Lin A, Lin CY, Wu JY, Niu DM.Molecular Genetics and Metabolism (2012), doi: 10.1016/j. ymgme.2012.01.021 4. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Streeter E, Al-Magableh M, Hart JL, Badoer E.Front Physiol. 2011;2:55. Epub 2011 Sep 1. 5. Interdependency of Cystathione ?^-Lyase and Cystathione ?]-Synthase in Hydrogen Sulfide-Induced Blood Pressure Regulation in Rats. Roy A, Khan AH, Islam MT, Prieto MC, Majid DS.Am J Hypertens. 2011 Aug 25. doi: 10.1038/ajh.2011.149. 6. Placental markers of folate-related metabolism in preeclampsia. Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY.Reproduction. 2011 Jun 20. 7. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Ren YS, Wu SY, Wang XJ, Yu F, Zhao J, Tang CS, Ouyang JP, Geng B.Chin Med J 2011;124(21):3468-3475. 8. Hydrogen Sulfide Modulates Contractile Function in Rat Jejunum. Kasparek MS, Linden DR, Farrugia G, Sarr MG.J Surg Res. 2011 Apr 22. 9. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase. Yamamoto T, Takano N, Ishiwata K, Suematsu M.J. Clin. Biochem. Nutr., 48, 96-100, 2010. 10. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Predmore BL, Alendy MJ, Ahmed KI, Leeuwenburgh C, Julian D.Age (Dordr). 2010 Dec;32(4):467-81. Epub 2010 May 26. 11. A Crucial Role for Hydrogen Sulfide in Oxygen Sensing via Modulating Large Conductance Calcium-Activated Potassium Channels. Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, Jiang LH, Rong W.Antioxid Redox Signal. 2010 May 15;12(10):1179-89. 12. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. Majtan T, Liu L, Carpenter JF, Kraus JP.J Biol Chem. 2010 Mar 22. 13. Actions of hydrogen sulphide on ion transport across rat distal colon. Hennig B, Diener M.Br J Pharmacol. 2009 Nov;158(5):1263-75. Epub 2009 Sep 25. 14. The endogenous hydrogen sulfide producing enzyme cystathionine-?] synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Xu GY, Winston JH, Shenoy M, Zhou S, Chen JD, Pasricha PJ.Mol Pain. 2009 Aug 6;5:44. 15. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Lee M, Schwab C, Yu S, McGeer E, McGeer PL.Neurobiol Aging. 2009 Oct;30(10):1523-34. Epub 2009 Jul 23. 16. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL.Dig Liver Dis. 2009 Jun 29. 17. Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats. Wallace JL, Vong L, McKnight W, Dicay M, Martin GR.Gastroenterology. 2009 Aug;137(2):569-78, 578.e1. Epub 2009 Apr 16. 18. Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. Majtan T, Singh LR, Wang L, Kruger WD, Kraus JP.J Biol Chem. 2008 Dec 12;283(50):34588-95. Epub 2008 Oct 10. 19. Hydrogen sulfide enhances ulcer healing in rats. Wallace JL, Dicay M, McKnight W, Martin GR.FASEB J. 2007 Dec;21(14):4070-6. Epub 2007 Jul 18. 20. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M.Gastroenterology. 2006 Nov;131(5):1542-52. Epub 2006 Aug 18.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
875
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,863 Da
NCBI Official Full Name
cystathionine beta-synthase
NCBI Official Synonym Full Names
cystathionine-beta-synthase
NCBI Official Symbol
CBS
NCBI Official Synonym Symbols
HIP4
NCBI Protein Information
cystathionine beta-synthase; beta-thionase; methylcysteine synthase; serine sulfhydrase
UniProt Protein Name
Cystathionine beta-synthase
UniProt Gene Name
CBS
UniProt Entry Name
CBS_HUMAN

Uniprot Description

CBS: Only known pyridoxal phosphate-dependent enzyme that contains heme. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Defects in CBS are the cause of cystathionine beta- synthase deficiency (CBSD). CBSD is an enzymatic deficiency resulting in altered sulfur metabolism and homocystinuria. The clinical features of untreated homocystinuria due to CBS deficiency include myopia, ectopia lentis, mental retardation, skeletal anomalies resembling Marfan syndrome, and thromboembolic events. Light skin and hair can also be present. Biochemical features include increased urinary homocystine and methionine. Belongs to the cysteine synthase/cystathionine beta- synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Other Amino Acids Metabolism - selenoamino acid; Amino Acid Metabolism - cysteine and methionine; Amino Acid Metabolism - glycine, serine and threonine; Lyase; EC 4.2.1.22

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: intracellular membrane-bound organelle; nucleolus; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; enzyme binding; cystathionine beta-synthase activity; ubiquitin protein ligase binding; metal ion binding; heme binding; pyridoxal phosphate binding

Biological Process: cysteine biosynthetic process via cystathionine; homocysteine catabolic process; sulfur amino acid metabolic process; L-serine metabolic process; transsulfuration; cysteine biosynthetic process from serine; homocysteine metabolic process; L-serine catabolic process; L-cysteine catabolic process

Disease: Homocystinuria Due To Cystathionine Beta-synthase Deficiency

Similar Products

Product Notes

The CBS cbs (Catalog #AAA6210597) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CBS (Cystathionine beta-synthase, Serine Sulfhydrase, Beta-thionase) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBS can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CBS cbs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CBS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.