Mouse anti-Human SCAP1 Monoclonal Antibody | anti-SCAP1 antibody

SCAP1 (SKAP1, SKAP55, Src Kinase-associated Phosphoprotein 1, Src Family-associated Phosphoprotein 1, Src kinase-associated Phosphoprotein of 55kD) (MaxLight 490)

Cat. Num. AAA6203154

• Gene Names: SKAP1; SCAP1; SKAP55; HEL-S-81p
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SCAP1; Monoclonal Antibody; SCAP1 (SKAP1; SKAP55; Src Kinase-associated Phosphoprotein 1; Src Family-associated Phosphoprotein 1; Src kinase-associated Phosphoprotein of 55kD) (MaxLight 490); anti-SCAP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C11
• Specificity: Recognizes human SCAP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

• Applicable Applications for anti-SCAP1 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from SCAP1 (NP_003717) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK*
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-SCAP1 antibody

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Product Categories/Family for anti-SCAP1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 115527074
• NCBI GeneID: 8631
• NCBI Accession #: NP_003717
• NCBI GenBank Nucleotide #: NM_003726
• UniProt Accession #: Q86WV1
• Molecular Weight: 41kDa
• NCBI Official Full Name: src kinase-associated phosphoprotein 1 isoform 1
• NCBI Official Synonym Full Names: src kinase associated phosphoprotein 1
• NCBI Official Symbol: SKAP1
• NCBI Official Synonym Symbols: SCAP1; SKAP55; HEL-S-81p
• NCBI Protein Information: src kinase-associated phosphoprotein 1
• UniProt Protein Name: Src kinase-associated phosphoprotein 1
• UniProt Gene Name: SKAP1
• UniProt Synonym Gene Names: SCAP1; SKAP55; SKAP-55; pp55
• UniProt Entry Name: SKAP1_HUMAN

NCBI Description

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008]

Uniprot Description

SKAP55: Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells. Belongs to the SKAP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cytoplasm; plasma membrane; intercellular junction; nucleus

Molecular Function: protein binding; SH3/SH2 adaptor activity; protein complex binding; SH2 domain binding; SH3 domain binding; protein phosphatase binding; protein kinase binding

Biological Process: positive regulation of signal transduction; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; T cell receptor signaling pathway