Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SCAP1 Monoclonal Antibody | anti-SCAP1 antibody

SCAP1 (SKAP1, SKAP55, Src Kinase-associated Phosphoprotein 1, Src Family-associated Phosphoprotein 1, Src kinase-associated Phosphoprotein of 55kD) (HRP)

Gene Names
SKAP1; SCAP1; SKAP55; HEL-S-81p
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCAP1; Monoclonal Antibody; SCAP1 (SKAP1; SKAP55; Src Kinase-associated Phosphoprotein 1; Src Family-associated Phosphoprotein 1; Src kinase-associated Phosphoprotein of 55kD) (HRP); anti-SCAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C11
Specificity
Recognizes human SCAP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SCAP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from SCAP1 (NP_003717) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(SCAP1 monoclonal antibody Western Blot analysis of SCAP1 expression in Jurkat.)

Western Blot (WB) (SCAP1 monoclonal antibody Western Blot analysis of SCAP1 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged SCAP1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCAP1 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SCAP1 antibody
This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.
Product Categories/Family for anti-SCAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
src kinase-associated phosphoprotein 1 isoform 1
NCBI Official Synonym Full Names
src kinase associated phosphoprotein 1
NCBI Official Symbol
SKAP1
NCBI Official Synonym Symbols
SCAP1; SKAP55; HEL-S-81p
NCBI Protein Information
src kinase-associated phosphoprotein 1
UniProt Protein Name
Src kinase-associated phosphoprotein 1
UniProt Gene Name
SKAP1
UniProt Synonym Gene Names
SCAP1; SKAP55; SKAP-55; pp55
UniProt Entry Name
SKAP1_HUMAN

NCBI Description

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins. [provided by RefSeq, Jul 2008]

Uniprot Description

SKAP55: Positively regulates T-cell receptor signaling by enhancing the MAP kinase pathway. Required for optimal conjugation between T-cells and antigen-presenting cells by promoting the clustering of integrin ITGAL on the surface of T-cells. May be involved in high affinity immunoglobulin epsilon receptor signaling in mast cells. Belongs to the SKAP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cytoplasm; plasma membrane; intercellular junction; nucleus

Molecular Function: protein binding; SH3/SH2 adaptor activity; protein complex binding; SH2 domain binding; SH3 domain binding; protein phosphatase binding; protein kinase binding

Biological Process: positive regulation of signal transduction; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; T cell receptor signaling pathway

Research Articles on SCAP1

Similar Products

Product Notes

The SCAP1 skap1 (Catalog #AAA6154827) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCAP1 (SKAP1, SKAP55, Src Kinase-associated Phosphoprotein 1, Src Family-associated Phosphoprotein 1, Src kinase-associated Phosphoprotein of 55kD) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCAP1 skap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.